OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products basf

Our Manufacturer

basf
BASF Bisabolol Rac is a synthetic, anti-inflammatory active ingredient used in personal care products to soothe and heal skin, making it ideal for sensitive skin, baby care, after-sun and after-shave products. It protects and calms skin, reducing redness and irritation from daily stress
Basf Bisabolol Rac

INR 700

VIEW DETAILS
Lamesoft PO 65 is preferably used as a lipid layer enhancer for the production of surfactant cleansing preparations.  lipid layer enhancer Lamesoft Po 65.
Basf Lamesoft Po 65

INR 500

VIEW DETAILS
BASF Eumulgin L is a non-ionic emulsifier and solubilizer used in water and water/alcohol-based personal care products, including creams, lotions, shampoos, conditioners, and sun care products.
BASF Eumulgin L

INR 650

VIEW DETAILS
BASF Eumulgin CO 40, a PEG-40 hydrogenated castor oil, is a non-ionic emulsifier and solubilizer used in a variety of aqueous cosmetic preparations and personal care products. Its primary uses are to blend oil and water in O/W (oil-in-water) emulsions and to dissolve oil-soluble substances like fragrances and extracts into water-based formulas
BASF Eumulgin CO 40

INR 900

VIEW DETAILS
BASF's Irgacare MP, a triclosan-based antimicrobial agent, is used in oral care products like toothpastes and mouthwashes for its efficacy against bacteria, molds, and yeasts, and in healthcare applications, such as antibacterial sutures, for its ability to prevent infections
BASF's Irgacare MP

INR 700

VIEW DETAILS
Irgasan DP 300, also known as Triclosan, is a broad-spectrum antimicrobial used in various personal care, hygiene, and healthcare products, including bar soaps, liquid soaps, shower gels, hand washes, deodorants, and acne preparations
Basf Irgasan Dp 300

INR 1500

VIEW DETAILS
BASF Dehyton MC, whose active ingredient is Sodium Cocoamphoacetate, is an amphoteric surfactant used in personal care and cleansing products for its mild, non-irritating cleansing and conditioning properties. Its primary uses include facial cleansers, shampoos, body washes, liquid soaps, personal care wipes, and baby care products
Basf Dehyton Mc Sodium Coco Ampho Acet

INR 900

VIEW DETAILS
BASF Plantapon TF Decyl Glucoside (and) Polyglyceryl-10 Caprylate/Caprate (and) Coco-Glucoside (and) Glyceryl Oleate is a natural, sulfate-free surfactant blend used in mild cleansing products for sensitive skin and baby care. It provides gentle, tear-free cleansing while conditioning the skin and hair, leaving them feeling nourished and smooth. Its gentle cleansing properties make it ideal for various applications, including baby washes, facial cleansers, shampoos, and general body washes
Basf Plantapon Tf

INR 700

VIEW DETAILS
BASF Plantapon LGC Sorb Sodium Lauryl Glucose Carboxylate and Lauryl Glucoside is a mild, anionic surfactant used in personal care products like shampoos, body washes, facial cleansers, liquid hand soaps, and baby care items.
BASF Plantapon LGC Sorb

INR 700

VIEW DETAILS
BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
Basf Plantacare Series 2000/1200/818/8

INR 350

VIEW DETAILS
BASF Plantapon SF is a mild surfactant mixture used in cosmetic products for personal care, including shampoos, facial washes, baby cleansers, shower gels, and liquid soaps. Having contents Sodium Coco Ampho Acetate & Glycerin &Lauryl Glucoside & Sodium Cocoyl Glutamate & Sodium Lauryl Glucose Carboxylate.
BASF Plantapon SF

INR 750

VIEW DETAILS
BASF's Euperlan PCO is a self-dispersible opacifier used in a variety of personal care products, such as shampoos, liquid soaps, and bath and shower gels, to impart a creamy, white, and dense appearance to the formulations
BASF's Euperlan PCO

INR 740 INR 750
You Save 1.33%

VIEW DETAILS
BASF Euperlan PK 771 is a cold-processable, surfactant-based pearlizing and refatting agent used in personal care products like shampoos, bubble baths, and body washes to provide a creamy, pearlescent visual effect and a mild, skin-friendly profile. It creates a visually appealing, silky, and dense product appearance, enhancing the overall appeal of these formulations.
BASF Euperlan PK 771

INR 700

VIEW DETAILS
BASF's Cutina EGMS (Glycol Stearate) is a pearlizing and opacifying agent primarily used in personal care products like shampoos, body washes, liquid soaps, and facial cleansers to give them a rich, pearly appearance and improve consistency
Basf Cutina Egms

INR 750

VIEW DETAILS
NEUROBIOX is a COSMOS-approved skin care ingredient, specifically an active from yarrow extract, used to promote skin regeneration and anti-aging effects by stimulating POMC receptor expression, reducing the appearance of wrinkles and pores, increasing skin thickness, and improving skin softness and radiance
NEUROBIOX ( COSMOS ) BASF

INR 2498 INR 2500
You Save 0.08%

VIEW DETAILS
Tetra Sodium EDTA TRILON B BASF, Trilon B, a BASF chelating agent that is the tetra sodium salt of EDTA, is used in several key sectors including laundry, food and beverage processing, and industrial cleaning. Call for latest price and COA.
Tetra Sodium EDTA TRILON B BASF
VIEW DETAILS
BASF POLYOLS, Reactive Polymer Polyols, Polymer Polyols, Amine Based Polyols, Slabstock Polyols, case polyols available Lupranol 1000-1Lupranol 1000-2Lupranol 1005-1Lupranol 1100-1Lupranol 1200Lupranol 2004-1Lupranol 2007-1Lupranol 2043Lupranol 2048Lupranol 2090Lupranol 2092Lupranol 2905Lupranol 2072Lupranol 2074Lupranol 2074-2Lupranol 2070Lupranol 1002-1Lupranol 3402Lupranol 3508-1Lupranol 4002-1Lupranol 4005-1-SC10Lupranol 4005-1-SC15Lupranol 4005-1-SC25Lupranol 4003-1Lupranol 4010-1-SC15Lupranol 4010-1-SC25Contact for stock availability and pricing
BASF POLYOLS SUPPLIERS

INR 590 INR 600
You Save 1.67%

VIEW DETAILS
BASF LANETTE 18 Stearyl Alcohol, supplier of BASF LANETTE 18 Stearyl Alcohol, used in antiperspirants & deodorants, sun-care (after-sun, sun-protection, self-tanning), color-, body & face care and face cleansing formulations. Also used in baby care & cleansing, hair coloring and conditioning formulations. The shelf life of this ingredient is 2 years.
BASF LANETTE 18 Stearyl Alcohol

INR 890 INR 900
You Save 1.11%

VIEW DETAILS
Basf Luviskol Va-64-W,Luviskol VA 64 W is a film-forming agents and fixatives in hair care, particularly in aerosol sprays, pump sprays, liquid products, mouses and gels. It is an easy-to-use aqueous solution that is compatible with carbomers, and is particularly suitable for alcohol-free formulations, forming a clear solution in water.
Basf Luviskol Va 64 W
VIEW DETAILS
Basf Cosmedia Sp, Sodium Polyacrylate, Basf Chemicals Importer, stockiest of basf chemicals
Basf Cosmedia Sp
VIEW DETAILS
Basf Cosmedia Sp, Sodium Polyacrylate, Basf Chemicals Importer, stockiest of basf chemicals
Basf Cosmedia Sp
VIEW DETAILS
Basf Cosmedia AtcAcrylamide Sodium Acrylate Copolymer Mineral Oil Trideceth-6, basf cosmetic industry chemicals,
Basf Cosmedia Atc
VIEW DETAILS
BASF TEXAPON N 70 OFFER TO SELL BASF MAKE TEXAPON N 70 LIQUID ApplicationLaundryDishwashingHard Surface CleaningFood and Beverage ProcessingFood Service and Kitchen HygieneCommercial LaundryInstitutional Cleaning and SanitationVehicle and Transportation Care
TEXAPON N 70

INR 218 INR 220
You Save 0.91%

VIEW DETAILS
BASF TEXAPON N 70 OFFER TO SELL BASF MAKE TEXAPON N 70 LIQUID ApplicationLaundryDishwashingHard Surface CleaningFood and Beverage ProcessingFood Service and Kitchen HygieneCommercial LaundryInstitutional Cleaning and SanitationVehicle and Transportation Care
TEXAPON N 70

INR 218 INR 220
You Save 0.91%

VIEW DETAILS
Sodium acrylates copolymers and mineral Oil (effective thickener low concentrations)Basf Tinovis AdeCosmetic Chemicals, It is used in after-sun, sun protection, baby care & cleansing, body-, face & color care products, face cleansing and personal care wipes.
Basf Tinovis Ade
VIEW DETAILS
Basf Tinosorb M Methylene, BIS Benzotriazolyl Tetramethyl butyl phenol MBBT, cosmetic chemicals, skin damage chemicals
Basf Tinosorb M Methylene BIS Benzotri
VIEW DETAILS
Basf Tinosorb S Bis-Ethylhexyloxyphenol Methoxyphenyl TriazineSun Screen Chemicals, Sun Burn Chemicals, UVB radiation protection chemicals, basf chemicals
Basf Tinosorb S Bis-Ethylhexyloxypheno
VIEW DETAILS
Basf Uvinul Mc 80 OMC Ethyl hexyl methoxy cinnamate, sun screen chemicals, anti aging chemicals basf
Basf Uvinul Mc 80 OMC (Ethyl hexyl met
VIEW DETAILS
Basf Uvinul T 150, Ethylhexyl TriazoneBasf Cosmetic Chemicals stock available
Basf Uvinul T 150 Ethylhexyl Triazone
VIEW DETAILS
BASF Lupranol 2070,Lupranol 2072,Lupranol 2074,Lupranol 2074/2 Polyols, Slabstock polyol with low-emission and scorch-optimized antioxidant package. DMC catalyzed. Conventional slabstock polyol with scorch-optimized antioxidant package. DMC catalyzed. Slabstock polyol with emission optimized antioxidant package. Produced by KOH catalysis.
Slabstock Polyols

INR 448 INR 450
You Save 0.44%

VIEW DETAILS
All reactive polyols have an ethylene oxide (EO) end-cap, creating a primary hydroxyl group. All reactive polyols are produced by KOH catalysis and contain an antioxidant package that is free of 2,6-di-tert.butyl-p-cresol (BHT), enabling their usage in applications where low emissions are important. Reactive polyols are mainly used for molded applications like flexible foams, flexible integral foams, RIM and shoe soles, as well as for CASE applications.Lupranol 2007/1Lupranol 2043Lupranol 2048Lupranol 2090Lupranol 2092Lupranol 2905Diol. reactive polyol for molded applications and CASE, Reactive polyols for molded and CASE applications, Cell opener polyol for flexible foam.
Reactive Polyols

INR 246 INR 248
You Save 0.81%

VIEW DETAILS
BASF TERT-BUTYLAMINE, IMPORTER OF TERT-BUTYLAMINE, QUALITY TERT-BUTYLAMINE,
TERT-BUTYLAMINE

INR 396 INR 398
You Save 0.5%

VIEW DETAILS
Tryptophan is an α-amino acid that is used in the biosynthesis of proteins. Tryptophan contains an α-amino group, an α-carboxylic acid group, and a side chain indole, making it a non-polar aromatic amino acid. It is essential in humans, meaning that the body cannot synthesize it and it must be obtained from the diet.
L Tryptophan
VIEW DETAILS
Glyoxal is also used in berberine hydrochloride and sulfa drugs sulfanilamide methoxyl pyrazine synthesis. Also used for pest control agent, deodorant, body preservatives, sand mould curing agent. Glyoxal is supplied typically as a 40% solution.
GLYOXAL 40%

INR 85

VIEW DETAILS
Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
Foamaster Series Additives

INR 530 INR 550
You Save 3.64%

VIEW DETAILS
Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
Mastertile 25 Grey

INR 469 INR 475
You Save 1.26%

VIEW DETAILS
Non-shrink, cementitious grout for use in general civil engineering worksBASF MasterFlow 718 is a ready to use, non-shrink, natural aggregate cementitious grout for use in general civil engineering works.MasterFlow 718 provides extended working life and high early and ultimate strengths.RECOMMENDED USESMasterFlow 718 is recommended for:• stanchion baseplates and columns;• prefabricated concrete panels and beams;• bridge bearing plates;• anchor bolts and bars;• underpinning;• patch repair works.FEATURES AND BENEFITS• High strength - provides good early and ultimatestrengths which ensure quick return to serviceand long term durability• Non shrink - Hardens free of bleeding,settlement and drying shrinkage when placed atflowable consistency• Flowable consistency - Ensures complete fillingof even intricate voids often without the need forpumping and strapping• Ample working time - remains placeable – up to1 hour - even at high ambient temperatures• Dense, impermeable grout - Provides a goodwatertight seal• Economical - Greater volumes of grout can bemixed and handled with less labour.• Easy to use - requires no special mixingequipment, it can be mixed in a pail using a groutstirrer.• No added chloride – Does not add to chlorideload on structure• Provides complete non shrink performance-When tested in accordance with simulatedBedplate Technique.• Versatile- Can be placed from flowable totrowelable consistency
MasterFlow 718

INR 440 INR 450
You Save 2.22%

VIEW DETAILS
Pat Impex is a leading dealer & distributor of BASF MasterEmaco 131, BASF MasterEmaco 131, BASF MasterEmaco 488, BASF MasterEmaco S 346, BASF MasterEmaco S 348, BASF MasterEmaco SBR 2, BASF MasterEmaco SBR 2.BASF’s MasterEmaco product system under the Master Builders Solutions brand offers comprehensive solutions for concrete that has been damaged or deteriorated by changing weather conditions, chloride ions, contaminants and extreme environments.The MasterEmaco portfolio of primers, cementitious and resinous repair mortars and fairing coats make up a complete system approach that is used to substitute deteriorated concrete and re-establish the original strength, structural integrity and aesthetics.Formulated to be wet or dry spray applied, formed or hand troweled, the MasterEmaco line of superior performance products re-establish the long-term durability and load bearing capacity of concrete. Working quickly to allow a fast return to service, they match the concrete’s strength, improve the aesthetics and prolong the lifecycle of the building or structure.
MasterEmaco

INR 33 INR 38
You Save 13.16%

VIEW DETAILS
Distributors, Stockist, Importers, Agents of Chemours BASF Titanium Dioxide rutile R 105-706-350Superior weather resistanceOutstanding properties in molding and extrusion resinsExcellent opacity and neutral undertoneVery high dispersibility in plasticized vinyl, plasticizers, and liquidsFlocculation resistanceGood gloss retentionResistance to chromaphore formationApplications where Ti-Pure™ R-105 is of particular value are:Injection molding, blow molding, and blown film of polyethylene or polypropyleneRigid interior, flexible, and plastisol PVC, as well as PVC used for composite and sheet flooringLead-stabilized PVC systems and nonchalking exterior PVCDurable exterior polyethylene or polypropyleneExterior architectural applications requiring high gloss and maximum durabilityEmulsion trim paints where maximum initial gloss and outstanding exterior durability are preferredRefinish and OEM topcoat applications requiring high gloss, distinctness of image, and resistance to weatheringManufacturing operations demanding fast wet-in and easy dispersionHigh-durability industrial applications including coil coatings for residential aluminum siding, architectural building panels, and aerospace coatingsThermoplastic masterbatches needing high concentrations of pigment and minimal melt flow impactPolyolefin products with improved resistance to additive yellowingPolyolefin films for outdoor applicationsABS ApplicationsAutomotive OEM topcoat and refinishAerospace coatingsPremium-quality exterior finishes and high durability exterior coil coatingsPowder coatingsIndustrial OEM
Chemours Titanium Dioxide Rutile R 105

INR 275 INR 280
You Save 1.79%

VIEW DETAILS
CROMOPHTAL YELLOW K 1410 Colour Pigments, Organic & High Performance Pigments from BASF.
CROMOPHTAL YELLOW K 1410
VIEW DETAILS
Kollidon® 25 (Chemical Name - Polyvinylpyrrolidone) has been used successfully for decades in pharmaceutical formulations – the adhesive, film-forming, dispersing and thickening properties of soluble Kollidon® are used in tablet binding, sugar coating, film coating, solubilization, stabilization and numerous other ways.The improvement in the solubility of active ingredients brought by complexation or association, and the thickening effect find use mainly in the manufacture of liquid dosage forms. The grade of Kollidon® that is selected depends mainly on its molecular weight, as this dictates the viscosity, binding effect, the complexation capacity and how readily it is eliminated by the body.
BASF Kollidon 25
VIEW DETAILS
Buy high quality BASF TAMOL nn & dn grades manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used Dispersing Agent for Chemical and Allied Industries, pigment & dyes industries at very competitive price.
BASF TAMOL
VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
BASF Bisabolol Rac is a synthetic, anti-inflammatory active ingredient used in personal care products to soothe and heal skin, making it ideal for sensitive skin, baby care, after-sun and after-shave products. It protects and calms skin, reducing redness and irritation from daily stress
View Details
Basf Bisabolol Rac

INR 700

Lamesoft PO 65 is preferably used as a lipid layer enhancer for the production of surfactant cleansing preparations.  lipid layer enhancer Lamesoft Po 65.
View Details
Basf Lamesoft Po 65

INR 500

BASF Eumulgin L is a non-ionic emulsifier and solubilizer used in water and water/alcohol-based personal care products, including creams, lotions, shampoos, conditioners, and sun care products.
View Details
BASF Eumulgin L

INR 650

BASF Eumulgin CO 40, a PEG-40 hydrogenated castor oil, is a non-ionic emulsifier and solubilizer used in a variety of aqueous cosmetic preparations and personal care products. Its primary uses are to blend oil and water in O/W (oil-in-water) emulsions and to dissolve oil-soluble substances like fragrances and extracts into water-based formulas
View Details
BASF Eumulgin CO 40

INR 900

BASF's Irgacare MP, a triclosan-based antimicrobial agent, is used in oral care products like toothpastes and mouthwashes for its efficacy against bacteria, molds, and yeasts, and in healthcare applications, such as antibacterial sutures, for its ability to prevent infections
View Details
BASF's Irgacare MP

INR 700

Irgasan DP 300, also known as Triclosan, is a broad-spectrum antimicrobial used in various personal care, hygiene, and healthcare products, including bar soaps, liquid soaps, shower gels, hand washes, deodorants, and acne preparations
View Details
Basf Irgasan Dp 300

INR 1500

BASF Dehyton MC, whose active ingredient is Sodium Cocoamphoacetate, is an amphoteric surfactant used in personal care and cleansing products for its mild, non-irritating cleansing and conditioning properties. Its primary uses include facial cleansers, shampoos, body washes, liquid soaps, personal care wipes, and baby care products
View Details
Basf Dehyton Mc Sodium C

INR 900

BASF Plantapon TF Decyl Glucoside (and) Polyglyceryl-10 Caprylate/Caprate (and) Coco-Glucoside (and) Glyceryl Oleate is a natural, sulfate-free surfactant blend used in mild cleansing products for sensitive skin and baby care. It provides gentle, tear-free cleansing while conditioning the skin and hair, leaving them feeling nourished and smooth. Its gentle cleansing properties make it ideal for various applications, including baby washes, facial cleansers, shampoos, and general body washes
View Details
Basf Plantapon Tf

INR 700

BASF Plantapon LGC Sorb Sodium Lauryl Glucose Carboxylate and Lauryl Glucoside is a mild, anionic surfactant used in personal care products like shampoos, body washes, facial cleansers, liquid hand soaps, and baby care items.
View Details
BASF Plantapon LGC Sorb

INR 700

BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
View Details
Basf Plantacare Series 2

INR 350

BASF Plantapon SF is a mild surfactant mixture used in cosmetic products for personal care, including shampoos, facial washes, baby cleansers, shower gels, and liquid soaps. Having contents Sodium Coco Ampho Acetate & Glycerin &Lauryl Glucoside & Sodium Cocoyl Glutamate & Sodium Lauryl Glucose Carboxylate.
View Details
BASF Plantapon SF

INR 750

BASF's Euperlan PCO is a self-dispersible opacifier used in a variety of personal care products, such as shampoos, liquid soaps, and bath and shower gels, to impart a creamy, white, and dense appearance to the formulations
View Details
BASF's Euperlan PCO

INR 740 INR 750
You Save: INR 10 (1.33%)

BASF Euperlan PK 771 is a cold-processable, surfactant-based pearlizing and refatting agent used in personal care products like shampoos, bubble baths, and body washes to provide a creamy, pearlescent visual effect and a mild, skin-friendly profile. It creates a visually appealing, silky, and dense product appearance, enhancing the overall appeal of these formulations.
View Details
BASF Euperlan PK 771

INR 700

BASF's Cutina EGMS (Glycol Stearate) is a pearlizing and opacifying agent primarily used in personal care products like shampoos, body washes, liquid soaps, and facial cleansers to give them a rich, pearly appearance and improve consistency
View Details
Basf Cutina Egms

INR 750

NEUROBIOX is a COSMOS-approved skin care ingredient, specifically an active from yarrow extract, used to promote skin regeneration and anti-aging effects by stimulating POMC receptor expression, reducing the appearance of wrinkles and pores, increasing skin thickness, and improving skin softness and radiance
View Details
NEUROBIOX ( COSMOS ) BAS

INR 2498 INR 2500
You Save: INR 2 (0.08%)

Tetra Sodium EDTA TRILON B BASF, Trilon B, a BASF chelating agent that is the tetra sodium salt of EDTA, is used in several key sectors including laundry, food and beverage processing, and industrial cleaning. Call for latest price and COA.
View Details
Tetra Sodium EDTA TRILON
BASF POLYOLS, Reactive Polymer Polyols, Polymer Polyols, Amine Based Polyols, Slabstock Polyols, case polyols available Lupranol 1000-1Lupranol 1000-2Lupranol 1005-1Lupranol 1100-1Lupranol 1200Lupranol 2004-1Lupranol 2007-1Lupranol 2043Lupranol 2048Lupranol 2090Lupranol 2092Lupranol 2905Lupranol 2072Lupranol 2074Lupranol 2074-2Lupranol 2070Lupranol 1002-1Lupranol 3402Lupranol 3508-1Lupranol 4002-1Lupranol 4005-1-SC10Lupranol 4005-1-SC15Lupranol 4005-1-SC25Lupranol 4003-1Lupranol 4010-1-SC15Lupranol 4010-1-SC25Contact for stock availability and pricing
View Details
BASF POLYOLS SUPPLIERS

INR 590 INR 600
You Save: INR 10 (1.67%)

BASF LANETTE 18 Stearyl Alcohol, supplier of BASF LANETTE 18 Stearyl Alcohol, used in antiperspirants & deodorants, sun-care (after-sun, sun-protection, self-tanning), color-, body & face care and face cleansing formulations. Also used in baby care & cleansing, hair coloring and conditioning formulations. The shelf life of this ingredient is 2 years.
View Details
BASF LANETTE 18 Stearyl

INR 890 INR 900
You Save: INR 10 (1.11%)

Basf Luviskol Va-64-W,Luviskol VA 64 W is a film-forming agents and fixatives in hair care, particularly in aerosol sprays, pump sprays, liquid products, mouses and gels. It is an easy-to-use aqueous solution that is compatible with carbomers, and is particularly suitable for alcohol-free formulations, forming a clear solution in water.
View Details
Basf Luviskol Va 64 W
Basf Cosmedia Sp, Sodium Polyacrylate, Basf Chemicals Importer, stockiest of basf chemicals
View Details
Basf Cosmedia Sp
Basf Cosmedia Sp, Sodium Polyacrylate, Basf Chemicals Importer, stockiest of basf chemicals
View Details
Basf Cosmedia Sp
Basf Cosmedia AtcAcrylamide Sodium Acrylate Copolymer Mineral Oil Trideceth-6, basf cosmetic industry chemicals,
View Details
Basf Cosmedia Atc
BASF TEXAPON N 70 OFFER TO SELL BASF MAKE TEXAPON N 70 LIQUID ApplicationLaundryDishwashingHard Surface CleaningFood and Beverage ProcessingFood Service and Kitchen HygieneCommercial LaundryInstitutional Cleaning and SanitationVehicle and Transportation Care
View Details
TEXAPON N 70

INR 218 INR 220
You Save: INR 2 (0.91%)

BASF TEXAPON N 70 OFFER TO SELL BASF MAKE TEXAPON N 70 LIQUID ApplicationLaundryDishwashingHard Surface CleaningFood and Beverage ProcessingFood Service and Kitchen HygieneCommercial LaundryInstitutional Cleaning and SanitationVehicle and Transportation Care
View Details
TEXAPON N 70

INR 218 INR 220
You Save: INR 2 (0.91%)

Sodium acrylates copolymers and mineral Oil (effective thickener low concentrations)Basf Tinovis AdeCosmetic Chemicals, It is used in after-sun, sun protection, baby care & cleansing, body-, face & color care products, face cleansing and personal care wipes.
View Details
Basf Tinovis Ade
Basf Tinosorb M Methylene, BIS Benzotriazolyl Tetramethyl butyl phenol MBBT, cosmetic chemicals, skin damage chemicals
View Details
Basf Tinosorb M Methylen
Basf Tinosorb S Bis-Ethylhexyloxyphenol Methoxyphenyl TriazineSun Screen Chemicals, Sun Burn Chemicals, UVB radiation protection chemicals, basf chemicals
View Details
Basf Tinosorb S Bis-Ethy
Basf Uvinul Mc 80 OMC Ethyl hexyl methoxy cinnamate, sun screen chemicals, anti aging chemicals basf
View Details
Basf Uvinul Mc 80 OMC (E
Basf Uvinul T 150, Ethylhexyl TriazoneBasf Cosmetic Chemicals stock available
View Details
Basf Uvinul T 150 Ethylh
BASF Lupranol 2070,Lupranol 2072,Lupranol 2074,Lupranol 2074/2 Polyols, Slabstock polyol with low-emission and scorch-optimized antioxidant package. DMC catalyzed. Conventional slabstock polyol with scorch-optimized antioxidant package. DMC catalyzed. Slabstock polyol with emission optimized antioxidant package. Produced by KOH catalysis.
View Details
Slabstock Polyols

INR 448 INR 450
You Save: INR 2 (0.44%)

All reactive polyols have an ethylene oxide (EO) end-cap, creating a primary hydroxyl group. All reactive polyols are produced by KOH catalysis and contain an antioxidant package that is free of 2,6-di-tert.butyl-p-cresol (BHT), enabling their usage in applications where low emissions are important. Reactive polyols are mainly used for molded applications like flexible foams, flexible integral foams, RIM and shoe soles, as well as for CASE applications.Lupranol 2007/1Lupranol 2043Lupranol 2048Lupranol 2090Lupranol 2092Lupranol 2905Diol. reactive polyol for molded applications and CASE, Reactive polyols for molded and CASE applications, Cell opener polyol for flexible foam.
View Details
Reactive Polyols

INR 246 INR 248
You Save: INR 2 (0.81%)

BASF TERT-BUTYLAMINE, IMPORTER OF TERT-BUTYLAMINE, QUALITY TERT-BUTYLAMINE,
View Details
TERT-BUTYLAMINE

INR 396 INR 398
You Save: INR 2 (0.5%)

Tryptophan is an α-amino acid that is used in the biosynthesis of proteins. Tryptophan contains an α-amino group, an α-carboxylic acid group, and a side chain indole, making it a non-polar aromatic amino acid. It is essential in humans, meaning that the body cannot synthesize it and it must be obtained from the diet.
View Details
L Tryptophan
Glyoxal is also used in berberine hydrochloride and sulfa drugs sulfanilamide methoxyl pyrazine synthesis. Also used for pest control agent, deodorant, body preservatives, sand mould curing agent. Glyoxal is supplied typically as a 40% solution.
View Details
GLYOXAL 40%

INR 85

Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
View Details
Foamaster Series Additiv

INR 530 INR 550
You Save: INR 20 (3.64%)

Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
View Details
Mastertile 25 Grey

INR 469 INR 475
You Save: INR 6 (1.26%)

Non-shrink, cementitious grout for use in general civil engineering worksBASF MasterFlow 718 is a ready to use, non-shrink, natural aggregate cementitious grout for use in general civil engineering works.MasterFlow 718 provides extended working life and high early and ultimate strengths.RECOMMENDED USESMasterFlow 718 is recommended for:• stanchion baseplates and columns;• prefabricated concrete panels and beams;• bridge bearing plates;• anchor bolts and bars;• underpinning;• patch repair works.FEATURES AND BENEFITS• High strength - provides good early and ultimatestrengths which ensure quick return to serviceand long term durability• Non shrink - Hardens free of bleeding,settlement and drying shrinkage when placed atflowable consistency• Flowable consistency - Ensures complete fillingof even intricate voids often without the need forpumping and strapping• Ample working time - remains placeable – up to1 hour - even at high ambient temperatures• Dense, impermeable grout - Provides a goodwatertight seal• Economical - Greater volumes of grout can bemixed and handled with less labour.• Easy to use - requires no special mixingequipment, it can be mixed in a pail using a groutstirrer.• No added chloride – Does not add to chlorideload on structure• Provides complete non shrink performance-When tested in accordance with simulatedBedplate Technique.• Versatile- Can be placed from flowable totrowelable consistency
View Details
MasterFlow 718

INR 440 INR 450
You Save: INR 10 (2.22%)

Pat Impex is a leading dealer & distributor of BASF MasterEmaco 131, BASF MasterEmaco 131, BASF MasterEmaco 488, BASF MasterEmaco S 346, BASF MasterEmaco S 348, BASF MasterEmaco SBR 2, BASF MasterEmaco SBR 2.BASF’s MasterEmaco product system under the Master Builders Solutions brand offers comprehensive solutions for concrete that has been damaged or deteriorated by changing weather conditions, chloride ions, contaminants and extreme environments.The MasterEmaco portfolio of primers, cementitious and resinous repair mortars and fairing coats make up a complete system approach that is used to substitute deteriorated concrete and re-establish the original strength, structural integrity and aesthetics.Formulated to be wet or dry spray applied, formed or hand troweled, the MasterEmaco line of superior performance products re-establish the long-term durability and load bearing capacity of concrete. Working quickly to allow a fast return to service, they match the concrete’s strength, improve the aesthetics and prolong the lifecycle of the building or structure.
View Details
MasterEmaco

INR 33 INR 38
You Save: INR 5 (13.16%)

Distributors, Stockist, Importers, Agents of Chemours BASF Titanium Dioxide rutile R 105-706-350Superior weather resistanceOutstanding properties in molding and extrusion resinsExcellent opacity and neutral undertoneVery high dispersibility in plasticized vinyl, plasticizers, and liquidsFlocculation resistanceGood gloss retentionResistance to chromaphore formationApplications where Ti-Pure™ R-105 is of particular value are:Injection molding, blow molding, and blown film of polyethylene or polypropyleneRigid interior, flexible, and plastisol PVC, as well as PVC used for composite and sheet flooringLead-stabilized PVC systems and nonchalking exterior PVCDurable exterior polyethylene or polypropyleneExterior architectural applications requiring high gloss and maximum durabilityEmulsion trim paints where maximum initial gloss and outstanding exterior durability are preferredRefinish and OEM topcoat applications requiring high gloss, distinctness of image, and resistance to weatheringManufacturing operations demanding fast wet-in and easy dispersionHigh-durability industrial applications including coil coatings for residential aluminum siding, architectural building panels, and aerospace coatingsThermoplastic masterbatches needing high concentrations of pigment and minimal melt flow impactPolyolefin products with improved resistance to additive yellowingPolyolefin films for outdoor applicationsABS ApplicationsAutomotive OEM topcoat and refinishAerospace coatingsPremium-quality exterior finishes and high durability exterior coil coatingsPowder coatingsIndustrial OEM
View Details
Chemours Titanium Dioxid

INR 275 INR 280
You Save: INR 5 (1.79%)

CROMOPHTAL YELLOW K 1410 Colour Pigments, Organic & High Performance Pigments from BASF.
View Details
CROMOPHTAL YELLOW K 1410
Kollidon® 25 (Chemical Name - Polyvinylpyrrolidone) has been used successfully for decades in pharmaceutical formulations – the adhesive, film-forming, dispersing and thickening properties of soluble Kollidon® are used in tablet binding, sugar coating, film coating, solubilization, stabilization and numerous other ways.The improvement in the solubility of active ingredients brought by complexation or association, and the thickening effect find use mainly in the manufacture of liquid dosage forms. The grade of Kollidon® that is selected depends mainly on its molecular weight, as this dictates the viscosity, binding effect, the complexation capacity and how readily it is eliminated by the body.
View Details
BASF Kollidon 25
Buy high quality BASF TAMOL nn & dn grades manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used Dispersing Agent for Chemical and Allied Industries, pigment & dyes industries at very competitive price.
View Details
BASF TAMOL

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share