Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
food chemicals
4-Pentenoic acid is used as a chemical intermediate in organic synthesis, a building block for polymers and surfactants, and a flavoring agent with cheesy and fruity notes.
4-Pentenoic acid
VIEW DETAILS
Aloe vera extract powder is widely used for skin care, hair conditioning, and digestive health. It helps soothe sunburns, treat acne, and hydrate dry skin, while also supporting hair strength when mixed into masks.
Aloe vera extract powder
VIEW DETAILS
Premium Dutch Alkalised Natural Cocoa Powder,Supplier of Premium Dutch Alkalised Natural Cocoa Powder in Vadodara Gujarat India. Please contact for latest price. Premium Dutch Cocoa Powder Suppliers, Natural cocoa powder suppliers in India, Alkalised cocoa powder supplier in Vadodara Gujarat India.
Premium Dutch Alkalised Natural Cocoa
VIEW DETAILS
Jindal Euro 707 Cocoa Powder , 250g, delivers a premium chocolate flavor ideal for baking, cooking, and beverages. Known for its smooth texture and rich color, this cocoa powder enhances desserts and drinks. Elevate your culinary creations with the superior taste and quality of Jindal Cocoa Powder Euro 707
Jindal Euro 707 Cocoa Powder

INR 760

VIEW DETAILS
Jindal Cocoa Powder 101, 250g, provides a classic chocolate flavor essential for baking and beverages. With a fine texture and deep cocoa richness, it elevates cakes, cookies, hot chocolates, and savory dishes. A reliable choice for achieving delightful chocolatey creations at home or in professional settings.
Jindal Cocoa Powder 101
VIEW DETAILS
Jindal Euro 505 Cocoa Powder, 250g, offers a rich, intense chocolate flavor ideal for baking, beverages, and savory dishes. Alkalized for depth and smoothness, it ensures consistent quality in creating delicious desserts and enhancing culinary creations with its premium taste and dark color.,
Jindal Euro 505 Cocoa Powder

INR 700

VIEW DETAILS
Jindal 201 Cocoa Powder,250g, offers a robust chocolate flavor with a smooth texture, ideal for baking and beverages. Its deep color and rich aroma enhance desserts, hot drinks, and savory dishes. A versatile choice for achieving delicious results in both professional and home kitchens.
Jindal 201 Cocoa Powder
VIEW DETAILS
Jindal 301 Cocoa Powder ,250g, delivers a smooth and rich chocolate flavor, perfect for baking and beverages. Known for its fine texture and deep cocoa notes, it enhances desserts, hot chocolate, and savory recipes. Ideal for creating indulgent treats with consistent quality and superior taste. supplier of Jindal 301 Cocoa Powder in Vadodara Mumbai Karnataka Kerela Gujarat Rajasthan India.
Jindal 301 Cocoa Powder
VIEW DETAILS
Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations. Elevate your desserts and drinks with the superior quality of Jindal Cocoa Powder Euro 900
Jindal Euro 900 Cocoa Powder

INR 839

VIEW DETAILS
Hydrocarbon PolyterpeneAdhesives & Sealants: These are the primary applications, where polyterpenes are used as tackifiers in:Pressure-Sensitive Adhesives (PSAs): High-performance adhesives for tapes, labels, and specialty films.Hot-Melt Adhesives (HMAs): Used in packaging, carton closing, bookbinding, diapers, and sanitary products.Solvent-Based Adhesives: Used in rubber cements and friction tapes.Sealants & Mastics: Including tire puncture sealants.Rubber & Tire Industry: Polyterpenes act as tackifying agents in rubber compounding (natural rubber, SBR, neoprene, EVA), increasing bond strength and heat resistance.Paints, Coatings, and Inks: They improve adhesion, flexibility, and gloss, particularly in printing inks and specialty coatings.Food & Medical Applications: Due to their non-toxic nature, they are used in:Chewing Gum Base: Providing masticatory elasticity.Food Packaging: In films intended for indirect food contact.Medical Rubber Goods: Including medical-grade adhesive tapes.Paper Sizing: Used in the paper industry to improve moisture barrier properties and resistance to wetting.
Hydrocarbon Polyterpene
VIEW DETAILS
Vitamin A Acetate 325 cwd cws stock available, used in pharmaceutical and food and beverage industry. Best for fortifying foods. contact us for price
Vitamin A Acetate 325 CWD/CWS
VIEW DETAILS
Importer of Calcium D-pantothenate, Used in pharma industry as a additives and other treatment. Please contact for latest price and stock.
Calcium D-pantothenate
VIEW DETAILS
Monopropylene glycol (MPG) is a versatile, low-toxicity chemical used primarily as an industrial antifreeze/coolant, a solvent for pharmaceuticals and cosmetics, and a stabilizer in food products.
Monopropylene glycol (MPG)
VIEW DETAILS
Sodium cyclamate is a non-nutritive, high-intensity, heat-stable artificial sweetener used primarily in low-calorie foods, beverages, tabletop sweeteners, pharmaceuticals, and cosmetics, being 30-50 times sweeter than sugar. It is commonly used in combination with other sweeteners like saccharin to mask aftertastesFood and Beverage Industry: Used in diet sodas, canned fruits, jams, jellies, desserts, yogurt, and candies. It is particularly favored for its stability under heat, making it suitable for baking and cooking.Tabletop Sweeteners: Used in powder, tablet, or liquid forms for coffee, tea, and home use.Pharmaceuticals: Applied in medicines, such as oral liquids, syrups, and lozenges, to mask bitter tastes and improve patient compliance.Personal Care Products: Included in toothpaste, mouthwash, and lip gloss for a sweet taste without causing tooth decay.Industrial/Other Uses: Used in certain specialty products, such as fragrant coatings.
Sodium cyclamate
VIEW DETAILS
Sorbitan Tristearate is a non-ionic surfactant and emulsifier used to stabilize, texture, and prevent crystallization in foods, cosmetics, and pharmaceuticals. It acts as an anti-blooming agent in chocolate, prevents sandiness in margarine, and improves emulsion stability in creams, lotions, and industrial lubricants.
Sorbitan Tristearate
VIEW DETAILS
L-phenylalanine is an essential amino acid that the human body cannot produce on its own and must be obtained through diet or supplements. It is primarily found in protein-rich foods like meat, fish, eggs, and dairy. Stock Available L-phenylalanine in Vadodara Gujarat India.
L-phenylalanine
VIEW DETAILS
Calcium Acetate – Key Uses1️⃣ Pharmaceutical IndustryWidely used to control high blood phosphate levels in patients with chronic kidney disease.Works as a phosphate binder.Used in the formulation of various medicines and tablets.2️⃣ Food Industry (Food Additive – E263)Acts as a preservative, preventing mold and bacterial growth.Used as a buffering agent to maintain acidity.Commonly added in bakery products for improved texture and shelf life.3️⃣ Industrial ApplicationsUsed in textile and dyeing processes.Plays a role in lubricants, cement, and petroleum additives.Useful in production of acetone and other chemicals.4️⃣ Laboratory UsesEmployed as a reagent in chemical analysis and research.Helps in buffer preparation due to stable pH behavior.
Calcium Acetate

INR 66

VIEW DETAILS
Glycerol monostearate (GMS) is used as an emulsifier, thickener, and stabilizer in food, cosmetics, and pharmaceuticals
Glycerol monostearate (GMS)
VIEW DETAILS
Potassium Chloride BP IP USP Food GradeSalt substitute: Acts as a salt substitute in low-sodium products to reduce sodium intake while providing a similar salty taste, often mixed with regular salt to mitigate its bitter flavor.Flavor enhancer: Used as a flavor enhancer in food processing.Nutrient supplement: Added to foods as a source of potassium.Stabilizer and thickener: Functions as a stabilizer and thickener in certain products.
Potassium Chloride BP IP USP Food Grad

INR 200

VIEW DETAILS
Mono Potassium Phosphate ACS LR AR IP BP USPMono potassium phosphate (MKP) is primarily used in laboratories as a buffer and pH regulator for life science research, such as in cell culture, biochemistry, and molecular biology techniques. Beyond lab use, both ACS and standard grades have wide applications, including as a food additive (E340) for stabilization and emulsification, as a high-purity source of phosphorus and potassium in fertilizers, and in specialty applications like sports drinks
Mono Potassium Phosphate ACS LR AR IP

INR 250

VIEW DETAILS
Magnesium chloride hexahydrate has a variety of uses including dust and ice control, deicing, as a fertilizer and feed supplement, in wastewater treatment, and in the production of Sorel cement. It is also used in biological research as an essential component in enzyme reactions and for maintaining cell integrity. Additionally, it serves as a mineral supplement in pharmaceuticals, cosmetics, and certain food and textile applications. We have all grades Magnesium Chloride Hexahydrate ACSMagnesium Chloride Hexahydrate ARMagnesium Chloride Hexahydrate BPMagnesium Chloride Hexahydrate CrystalsMagnesium Chloride Hexahydrate FlakeMagnesium Chloride Hexahydrate Food GradeMagnesium Chloride Hexahydrate IPMagnesium Chloride Hexahydrate LRMagnesium Chloride Hexahydrate USPPlease call for latest price.
Magnesium Chloride Hexahydrate ACS LR

INR 225

VIEW DETAILS
Ferrous Sulphate Heptahydrate ACS IP BP USP LR AR FOOD Grade is used as a source of iron for treating iron-deficiency anemia, as a reagent in chemical analysis and manufacturing of iron compounds. It is also a component in fertilizers to correct iron chlorosis in plants, a reducing agent in industrial processes, and a component in water treatment to remove phosphates.
Ferrous Sulphate Heptahydrate ACS IP B

INR 210

VIEW DETAILS
Dipotassium Phosphate ACS AR LR IP BP USP FOOD Grade has many uses, including as a food additive to stabilize beverages and prevent coagulation in non-dairy creamers, as a buffering agent in scientific and food applications, and as a source of potassium and phosphorus in fertilizers. It also serves as a component in dental products for tooth sensitivity, in microbiology for culturing bacteria, and in restaurant fire suppression systems to flush agent lines
Dipotassium Phosphate ACS AR LR IP BP

INR 120

VIEW DETAILS
Calcium Sulphate Dihydrate BP IP USP LR ACS Food Grade is used as a pharmaceutical excipient in tablets and capsules, a bone filler in orthopedic and dental applications, and as a food additive and processing aid for products like tofu. It also serves as a soil amendment in agriculture, improves soil structure, and provides calcium and sulfur.
Calcium Sulphate Dihydrate BP IP USP L

INR 190

VIEW DETAILS
Calcium Sulphate Anhydrous BP IP LR USP Food is a pharmaceutical-grade ingredient with uses as a diluent, disintegrant, and binder in tablets, a source of calcium in supplements and food, a firming agent in food processing (like tofu), a desiccant, and in dental and medical casting materials. It also functions as a filler in various industrial products and as a soil conditioner
Calcium Sulphate Anhydrous BP IP LR US

INR 190

VIEW DETAILS
Tri sodium citrate, also known as sodium citrate, has a wide range of uses due to its buffering, emulsifying, and sequestrant properties. It's commonly used as a food additive, in cleaning products, and even in medicine
Tri Sodium Citrate

INR 110

VIEW DETAILS
EDTA 2 NA-DISODIUM ETHYLENE DIAMINE suppliers, High quality EDTA 2 NA-DISODIUM ETHYLENE DIAMINE available in stock, Call for latest price.
EDTA 2 NA-DISODIUM ETHYLENE DIAMINE

INR 190

VIEW DETAILS
Sodium Propionate, Used in food industry  available in food and industrial grade in Vadodara Gujarat India.
Sodium Propionate

INR 140

VIEW DETAILS
Formalin is an aqueous solution of formaldehyde that has many uses, including as a preservative, disinfectant, and in tissue fixation. Medical labsFormalin is used to preserve tissues for histological examination. It's also used in vaccines to inactivate viruses and detoxify bacterial toxins. FoodFormalin is used as a preservative in fruits, vegetables, and fish in tropical countries. Disinfectant Industrial: Formalin is used as an industrial disinfectant. Funeral homes: Formalin is used as a disinfectant in funeral homes.
Formalin

INR 110 INR 120
You Save 8.33%

VIEW DETAILS
2-Furoic acid is used as a flavoring ingredient and to help sterilize and pasteurize foods.
2 Furoic Acid
VIEW DETAILS
Basf Nutrilan Milk Hydrolyzed Milk Protein, Food chemicals, stock available Basf Nutrilan Milk Hydrolyzed Milk Protein,
Basf Nutrilan Milk Hydrolyzed Milk Pro
VIEW DETAILS
Nutraceutical Chemicals, Pharma Excipients, Pharma Additives Chemicals, Importer of Chemicals in India.Acesulfame KAcitretinAdenosin 5 Monophosphate ampAdenosin 5 Triphosphate AtpAenosinAloe Vera Gel Concentrate Powder IPAmino AcidsAstaxanthinAstaxanthin 10% PowderBeta CaroteneBeta Carotene 10% & 20% & 30% NaturalBeta-sita Sterol 90%Bilberry ExtractBlack Current ExtractBlack Rice ExtractBorge OilxBoron Proteinate.  B 8 -10%Bromelain 2400 GduCalcium Ascorbate. BpCalcium FumarateCalcium Sodium CaseinateCapsicum Oleoresin 8% LiquidChlorella PowderCoco DiethanolamideCoco MonoethanolamideCocoa PowderCoenzyme Q10 99%Collagen PeptideCopper Proteinate. Cu 8-10%Cranberry ExtractCreatine MonohydrateDextroseDha OmegaD-mannoseDocosahexaenoic Acid Dha 10% & 20% VegEicosapentaenoic Acid Epa Veg SourceElderberry Extract ErythritolEvening Primerose OilFerrous AminoateFerrous AscorbateFerrous Bis GlycinateFerrous Glycine Sulphate.Ferrous Proteinate. Fe 8-10%Fructo OligosaccharidesFructoseGamma - Linolenic Acid Gia PowderGamma Aminobutyric Acid GabaGinko Biloba Extract 24.6Ginseng Extract & PowderGlucosamine Hydrochloride.UspGlucosamine Sulphate. Potassium Salt. UspGlucose D PowderGrape Seed Extract 95%Green Tea Extract 95%Iron Iii Hydroxide Polymaltose Complex. Fe 30-34%.Iron Hydroxide Polysucrose Com plex. Fe 30%Iron Polysaccharide Complex PicIron Protein SuccinylateIsoflavonesIsomaltL Ascorbyl PalmitateLactic AcidLactitolLuteinLutein Powder 10%LycopeneLycopene Powder & Liquid 6% & 10% NaturalMalt Extract PowderMaltitolMaltodextrineManganese Proteinate.Mn 8-10%Methyl Sulfonyl Methane.MsmMicrocrystalline Hydroxyapatite Complex MchcMilk CalciumMilk Calcium PowderMixed Carotenoids 10% 20% 30%Mulberry ExtractNattokinase 20000 Fu/gNeotameOat PowderOleic DiethanolamideOmega 3 Fatty Acid Veg 11 Dha : 33 EpaOrbitan Mono LauratePeptonePhosphatidylcholinePhosphatidylserinePhytosterol 95%Pink Bark ExtractPiperine 95%PolydextrosePregelatinised StarchProprietary EmulsifierQuercetin 95%Resistant StarchResveratrol ExtractRutoside Trihydrate 95%Silymarin 80% Uv DabSorbitan Mono OleateSorbitan Mono PalmitateSorbitan Mono StearateSorbitan Sesqui OleateSorbitan Tri OleateSorbitan Tri StearateSorbitol PowderSoy Isoflavone 40% ExtractSoya LecithinSoya ProteinSpirulina PowderStevia PowderSucraloseSucroseTocotrienols 50%TroxerutinTryptoneUnivestinWhey ProteinXylitolYeast Extract PowderZeaxanthinZeaxanthin 10% Powder
Nutraceutical - Pharma Additives Excip
VIEW DETAILS
Imported Pharma Excipients suppliers of food chemicals Nutrartis ChileKinsy SpainNuwen FranceEmbria Health Sciences USACentro Sperimentale Del Latte CSL SACCO System-ItalyKerry USAWaitaki New ZealandAvailable products ALAAlgalitheMacro-AlgaeEpiCorProbioticsBakers Yeast Beta GlucanBakers Yeast Beta GlucanKiwi fruit concentrate powderBlackcurrant extractGreenshell Mussel powderApplication in White to cream natural powdered Ingredient rich in Calcium for re-mineralization of bodyFood & Nutraceutical ApplicationFree-flowing natural brownish powder using Saccharomyces cerevisiae with specialised Fermenting & Drying processesCustomised blends & Individual strains from various spicies to suit customer needs with supreme clinical data & Excellent regulatory supportNaturally occurring complex carbohydrate-Beta 1,3/1,6 Glucan that is found in the cell walls of foods such as common baker’s yeastNaturally occurring complex carbohydrate-Beta 1,3/1,6 Glucan that is found in the cell walls of foods such as common baker’s yeastSpecialised processing & Freeze dried Kiwi fruit concentrate which maintains optimal Temperature & pH conditions to protect the active enzyme ActinidinConcentrated  nutritional extract from super fruit- Balckcurrant Cassis berry(ribes nigrum) standardised to 25% & 35% AnthocyaninLipid portion of Greenshell mussels is rich in Polysaturated fatty acids (PUFA) particularly EPA & DHA.
Imported Pharma Excipients

INR 278 INR 280
You Save 0.71%

VIEW DETAILS
Ethyl formate manufacturers suppliersflavoring agent in lemonade and artificial alcoholic beverages. It is used industrially as a solvent and as a fungicide and larvicide in processed foods such as dried fruits and cereals.
Ethyl formate

INR 193 INR 195
You Save 1.03%

VIEW DETAILS
2-ethyl- 3,5-dimethyl Pyrazineused in the food industry as a flavor ingredient for its characteristic roasted odor and flavor, reminiscent of roasted cocoa or nuts.
2-ethyl- 3,5-dimethyl Pyrazine
VIEW DETAILS
2,3,5 Trimethyl Pyrazine, It comes from baked food, fried barley, potatoes, and peanuts. 2,3,5-Trimethylpyrazine is used for the flavor in cocoa, coffee, chocolate, potato, cereal, and fried nuts.
2,3,5 Trimethyl Pyrazine

INR 240 INR 250
You Save 4%

VIEW DETAILS
2 3 Dimethyl Pyrazine,Used in meat, coffee, cocoa, soup and gravy products.
2,3 Dimethyl Pyrazine

INR 590 INR 600
You Save 1.67%

VIEW DETAILS
Trimethyl Ortho Acetate,Mainly used as chemical intermediate of pharmaceutical and agricultural chemicals. Used for compound medical intermediates of vitamin B1, vitamin A1 and sulfanilamide. Used in dye and spices industry, Medicine, agricultural chemicals and as paint additives
Trimethyl Ortho Acetate

INR 1590 INR 1600
You Save 0.62%

VIEW DETAILS
Benzenesulfonyl chloride reacts with Grignard reagents to form oxindoles from N-unsubstituted indoles. It is widely used to check the assay of thiamine in different food products. It is involved in the synthesis of alpha-disulfones, sulfonamides and sulfoante esters as precursor.
Benzene Sulphonyl Chloride

INR 190 INR 195
You Save 2.56%

VIEW DETAILS
Chlorine Dioxide Liquid and Powder, Chlorine dioxide is used for bleaching of wood pulp and for the disinfection (called chlorination) of municipal drinking water, treatment of water in oil and gas applications, disinfection in the food industry, microbiological control in cooling towers, and textile bleaching.
Chlorine Dioxide

INR 790 INR 800
You Save 1.25%

VIEW DETAILS
Trehalose and the food industry,Now widely used in to prolong food shelf life, trehalose protects foods from drying out, starch-containing products from going stale, and fruits and vegetables from discoloring. It also suppresses ice crystal growth in frozen foods, reducing food loss.
Trehalose

INR 690 INR 700
You Save 1.43%

VIEW DETAILS
CALCIUM SULPHATE ANHYDROUS IP BP LR AR ACS, Manufacturer of calcium sulphate fine chemicals, ip bp usp calcium sulphate, ar lr acs grade calcium sulphate stock available, pharma fine chemicals manufacturer,
CALCIUM SULPHATE ANHYDROUS IP BP LR AR

INR 228 INR 229
You Save 0.44%

VIEW DETAILS
Butylated hydroxyanisole (BHA) is an antioxidant consisting of a mixture of two isomeric organic compounds, 2-tert-butyl-4-hydroxyanisole and 3-tert-butyl-4-hydroxyanisole. It is prepared from 4-methoxyphenol and isobutylene. It is a waxy solid used as a food additive with the E number E320. The primary use for BHA is as an antioxidant and preservative in food, food packaging, animal feed, cosmetics, rubber, and petroleum products.[3] BHA also is commonly used in medicines, such as isotretinoin, lovastatin, and simvastatin, among others.
Butylated Hydroxyanisole BHA

INR 1498 INR 1500
You Save 0.13%

VIEW DETAILS
CALCIUM CHLORIDE FUSED, Calcium Chloride Fused (Calcium (II) chloride, Calcium dichloride, Calcium Chloride Dihydrate) is a source of calcium for production of other salts as well as a source of calcium for foods and beverages, used as an additive to cement, helps setting of concrete and helps solidify soil as well.
CALCIUM CHLORIDE FUSED

INR 14 INR 22
You Save 36.36%

VIEW DETAILS
Dextrose Monohydrate Pure IP BP USP, Dextrose mono, IP grade Dextrose monohydrate chemicals, Importer of Dextrose monohydrate
Dextrose Monohydrate Pure IP BP USP
VIEW DETAILS
CALCIUM ACETATE MONOHYDRATE IP BP USP LR AR,Calcium acetate binds phosphate in the diet to lower blood phosphate levels. Calcium acetate is used as a food additive, as a stabilizer, buffer and sequestrant, mainly in candy productsCALCIUM ACETATE MONOHYDRATE AR ACS,CALCIUM ACETATE MONOHYDRATE BP,CALCIUM ACETATE MONOHYDRATE FOOD,CALCIUM ACETATE MONOHYDRATE IP,CALCIUM ACETATE MONOHYDRATE LR,CALCIUM ACETATE MONOHYDRATE USP,food chemical, food ip bp usp chemicals,
CALCIUM ACETATE MONOHYDRATE IP BP USP

INR 169 INR 189
You Save 10.58%

VIEW DETAILS
Sodium Starch Glycolate BP USP Potato Based, Nutraceutical grade BP USP glycolate chemicals, starch BP USP Potato Based chemicals, Importer of Starch Glycolate BP USP chemicals,Call for latest pricing
Sodium Starch Glycolate Bp/usp (Potato
VIEW DETAILS
Ascorbic Acid Ip Bp USp Grade, Ascorbic acid ip, food ascorbic acid manufacturer,
Ascorbic Acid IP/BP/USP (Micronized)
VIEW DETAILS
Ethyl Paraben Sodium, Antifungal pharma intermediates, powder paraben sodium, paraben manufacturer
Ethyl Paraben Sodium

INR 1719 INR 1720
You Save 0.06%

VIEW DETAILS
Manufacturer and suppliers of Chiral Chemicals in Gujarat (INDIA).Di Para Toluoyl D Tartaric Acid AnhydrousDi Para Toluoyl D Tartaric Acid MonohydrateDi Para Toluoyl L Tartaric Acid AnhydrousDi Para Toluoyl L Tartaric Acid MonohydrateDi Benzoyl D Tartaric acid AnhydrousDi Benzoyl D Tartaric acid MonohydrateDi Benzoyl L Tartaric acid AnhydrousDi Benzoyl L Tartaric acid Monohydrate(+) Di Butyl L Tartrate(-) Di Butyl D Tartrate(+) Di Ethyl L Tartrate(-) Di Ethyl D TartrateD (-) Tartaric AcidL (+) Tartaric Acid(-) Di IsoPropyl L Tartrate(+) Di IsoPropyl D Tartrate(+) Dibenzoyl L Tartrate(-) Dibenzoyl D TartrateDi Para Anisoyl D Tartaric Acid AnhydrousDi Para Anisoyl L Tartaric Acid Anhydrous
CHIRAL CHEMICALS MANUFACTURER

INR 630 INR 650
You Save 3.08%

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediatefood supplementsbakery chemicalstofu processing chemicalsbone filler chemicalsdental chemicalsorthopedic chemicalsice control chemicalsdust control chemicalsepsom saltssports drinks chemicalsde icing chemicalsindian manufacturerbaddi himachal pradeshPharma Api Powderapi suppliershyderabad benzoic acidmanufacturer intermediatespat impex indiaanti scaling agentzinc chemicalsplant growth regulatormineral oilswater emulsionVadodara Gujarat Indiafluoride chemicalsDimethylaminoethanolDimethyl carbonatemumbai bhiwandi maharashtraDI-N-PROPYLAMINEzeolitesEDTA 4NA LiquidTetrasodium EDTAvadodara vapi ahmedabad suratfumaric acidGAMMA-BUTYROLACTONEMalasiya importerfood glycinepharma glycinecosmetic glycineimporter in indiapat impex glycineGlyoxylic acid 50%Hexylene glycolHydrazine Hydrate 80%Isobutyric acidtextile auxiliariestextile chemicalsdechlorination chemicalsUrsodeoxycholic Acidudca manufacturerGlycerine pitchGlycerine pitch manufacturerGlycerine pitch suppliersGlycerine pitch indiaHydroquinonesuppliers importersIsobutanolMalononitrileMELAMINE CYANURATEelectrical chemicalsMethylcyclohexaneisobutenecoal chemicalsMonoethanolaminesaluminium sulphatenickel chemicalszinc electroplatingconcrete repairglycoltextile coatingsdealer distributoruv coatingscurable coatingsresin raw materialculture mediaculture media baseorganometallic reducing agentchematek synhydrideTert-butyldimethylsilyl chlorideTitanocene dichloridecocoa powdersulphate chemicalsfoam boostermaize starchcapsules chemicalsdisintegrant chemicalscolor removal chemicalsdrying agent chemicalsdehydrating chemicalsink chemicalsuv adhesiveslithium chemicals

INR 110 INR 120
You Save: INR 10 (8.33%)

INR 278 INR 280
You Save: INR 2 (0.71%)

INR 193 INR 195
You Save: INR 2 (1.03%)

INR 240 INR 250
You Save: INR 10 (4%)

INR 590 INR 600
You Save: INR 10 (1.67%)

INR 1590 INR 1600
You Save: INR 10 (0.62%)

INR 190 INR 195
You Save: INR 5 (2.56%)

INR 790 INR 800
You Save: INR 10 (1.25%)

INR 690 INR 700
You Save: INR 10 (1.43%)

INR 228 INR 229
You Save: INR 1 (0.44%)

INR 1498 INR 1500
You Save: INR 2 (0.13%)

INR 14 INR 22
You Save: INR 8 (36.36%)

INR 169 INR 189
You Save: INR 20 (10.58%)

INR 1719 INR 1720
You Save: INR 1 (0.06%)

INR 630 INR 650
You Save: INR 20 (3.08%)

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate |food supplements |bakery chemicals |tofu processing chemicals |bone filler chemicals |dental chemicals |orthopedic chemicals |ice control chemicals |dust control chemicals |epsom salts |sports drinks chemicals |de icing chemicals |indian manufacturer |baddi himachal pradesh |Pharma Api Powder |api suppliers |hyderabad benzoic acid |manufacturer intermediates |pat impex india |anti scaling agent |zinc chemicals |plant growth regulator |mineral oils |water emulsion |Vadodara Gujarat India |fluoride chemicals |Dimethylaminoethanol |Dimethyl carbonate |mumbai bhiwandi maharashtra |DI-N-PROPYLAMINE |zeolites |EDTA 4NA Liquid |Tetrasodium EDTA |vadodara vapi ahmedabad surat |fumaric acid |GAMMA-BUTYROLACTONE |Malasiya importer |food glycine |pharma glycine |cosmetic glycine |importer in india |pat impex glycine |Glyoxylic acid 50% |Hexylene glycol |Hydrazine Hydrate 80% |Isobutyric acid |textile auxiliaries |textile chemicals |dechlorination chemicals |Ursodeoxycholic Acid |udca manufacturer |Glycerine pitch |Glycerine pitch manufacturer |Glycerine pitch suppliers |Glycerine pitch india |Hydroquinone |suppliers importers |Isobutanol |Malononitrile |MELAMINE CYANURATE |electrical chemicals |Methylcyclohexane |isobutene |coal chemicals |Monoethanolamines |aluminium sulphate |nickel chemicals |zinc electroplating |concrete repair |glycol |textile coatings |dealer distributor |uv coatings |curable coatings |resin raw material |culture media |culture media base |organometallic reducing agent |chematek synhydride |Tert-butyldimethylsilyl chloride |Titanocene dichloride |cocoa powder |sulphate chemicals |foam booster |maize starch |capsules chemicals |disintegrant chemicals |color removal chemicals |drying agent chemicals |dehydrating chemicals |ink chemicals |uv adhesives |lithium chemicals

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us