OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products detergent chemicals

Our Manufacturer

detergent chemicals
Lamesoft PO 65 is preferably used as a lipid layer enhancer for the production of surfactant cleansing preparations.  lipid layer enhancer Lamesoft Po 65.
Basf Lamesoft Po 65

INR 500

VIEW DETAILS
Irgasan DP 300, also known as Triclosan, is a broad-spectrum antimicrobial used in various personal care, hygiene, and healthcare products, including bar soaps, liquid soaps, shower gels, hand washes, deodorants, and acne preparations
Basf Irgasan Dp 300

INR 1500

VIEW DETAILS
BASF Plantapon TF Decyl Glucoside (and) Polyglyceryl-10 Caprylate/Caprate (and) Coco-Glucoside (and) Glyceryl Oleate is a natural, sulfate-free surfactant blend used in mild cleansing products for sensitive skin and baby care. It provides gentle, tear-free cleansing while conditioning the skin and hair, leaving them feeling nourished and smooth. Its gentle cleansing properties make it ideal for various applications, including baby washes, facial cleansers, shampoos, and general body washes
Basf Plantapon Tf

INR 700

VIEW DETAILS
BASF Plantapon LGC Sorb Sodium Lauryl Glucose Carboxylate and Lauryl Glucoside is a mild, anionic surfactant used in personal care products like shampoos, body washes, facial cleansers, liquid hand soaps, and baby care items.
BASF Plantapon LGC Sorb

INR 700

VIEW DETAILS
BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
Basf Plantacare Series 2000/1200/818/8

INR 350

VIEW DETAILS
BASF Plantapon SF is a mild surfactant mixture used in cosmetic products for personal care, including shampoos, facial washes, baby cleansers, shower gels, and liquid soaps. Having contents Sodium Coco Ampho Acetate & Glycerin &Lauryl Glucoside & Sodium Cocoyl Glutamate & Sodium Lauryl Glucose Carboxylate.
BASF Plantapon SF

INR 750

VIEW DETAILS
BASF Cutina Shine is a plant-derived ingredient used in personal care products for its ability to enhance shine and gloss while providing a rich, creamy texture and mild conditioning
BASF Cutina Shine

INR 500

VIEW DETAILS
BASF's Euperlan PCO is a self-dispersible opacifier used in a variety of personal care products, such as shampoos, liquid soaps, and bath and shower gels, to impart a creamy, white, and dense appearance to the formulations
BASF's Euperlan PCO

INR 740 INR 750
You Save 1.33%

VIEW DETAILS
BASF Euperlan PK 771 is a cold-processable, surfactant-based pearlizing and refatting agent used in personal care products like shampoos, bubble baths, and body washes to provide a creamy, pearlescent visual effect and a mild, skin-friendly profile. It creates a visually appealing, silky, and dense product appearance, enhancing the overall appeal of these formulations.
BASF Euperlan PK 771

INR 700

VIEW DETAILS
BASF's Cutina EGMS (Glycol Stearate) is a pearlizing and opacifying agent primarily used in personal care products like shampoos, body washes, liquid soaps, and facial cleansers to give them a rich, pearly appearance and improve consistency
Basf Cutina Egms

INR 750

VIEW DETAILS
Sodium Cocoyl IsethionateThis mild surfactant rightly referred to as baby foam, is obtained from coconut oil after undergoing a simple reaction.It is one of the best sulfate-free alternatives available in the market.Owing to its mild cleansing and high foaming capabilities, it is traditionally used to make solid shampoo bars, conditioner bars, syndet bars, and bath bombs.It is outstanding for use in products for color-treated hair.Its peculiarity lies in the fact that it resists hard water and therefore prevents the formation of scum, which ensures no residue is left behind.It lathers pretty well when used as a stand-alone surfactant base and hence appeals to the sense of cleaning.It offers beautiful, gentle “lace glove” lather to our products. It’s also naturally acidic, so it helps our end products have a skin-friendly pH with less (or no) adjusting.
SCI (Sodium Cocoyl Isethionate )

INR 145 INR 155
You Save 6.45%

VIEW DETAILS
Sodium Lauryl Ether Sulphate Sles 70%, Available of Godrej Sodium Lauryl Ether Sulphate, SLES Godrej Make, Sles for detergent, Importer of Sodium Lauryl Ether Sulphate Sles 70%.Sodium Lauryl Ether Sulfate (SLES) is a widely used surfactant, primarily in personal care and cleaning products. It's valued for its ability to create foam and lather, making it effective for cleaning and emulsifying.
Sodium Lauryl Ether Sulphate Sles 70%

INR 148

VIEW DETAILS
WHITE PHENYL CHEMICALSEmulsifier OP95Pine oil 20% 32Citronella oilRoseLemonMograOrangeLavenderJasminePara Chloro Meta Cresol (PCMC)Para Chloro Meta Xylneol (PCMX)Ortho Benzyl Para Chloro Phenol (OBPCP)
WHITE PHENYL CHEMICALS

INR 64 INR 65
You Save 1.54%

VIEW DETAILS
Neobor Borax Pentahydrate, Latest imports Neobor Borax Pentahydrate, Neobor Borax Pentahydrate is primarily used for viscosity control in detergents due to its high-quality formulation, acting as a solvent that can also be effective in killing insects and creating a mildly alkaline solution.
Neobor Borax Pentahydrate

INR 71 INR 72
You Save 1.39%

VIEW DETAILS
ATMP is an effective scale inhibitor used in various industrial applications such as industrial water treatment and detergents.
Amino Trimethylene Phosphonic Acid (AT

INR 75 INR 85
You Save 11.76%

VIEW DETAILS
Black Phenyl Raw Materials, Phenyl Raw Materials, Light Creosote oilMono Chloro PhenolPara Chloro Meta Xylenol PCMXRWC BoosterOrtho Benzyl Para Chloro Phenol OBPCPWe have ready stock of Black Phenyl Raw Materials in India.
Black Phenyl Raw Materials

INR 185 INR 200
You Save 7.5%

VIEW DETAILS
Sodium formate is used in industrial applications and the production of other chemicals. Sodium formate is used in the production of sodium hydrosulfate and formic acid. Sodium formate is also used in leather tanning, printing processes, as a food additive, and as an enzyme stabilizer in detergents.
Sodium Formate

INR 33 INR 35
You Save 5.71%

VIEW DETAILS
SODIUM ALUMINOSILICATE 4A ZEOLITE MFG. Natural zeolites are analcite, chabazite, natrolite, stilbite, heulandite, and thomsonite. Synthetic production of zeolites implies either a gel process (sodium silicate and alumina) or a clay process (kaolin). Both methods are quite complex, requiring the exchange of various rare-earth oxides. The effectiveness of zeolite depends on its pore size, which may be as small as 4A.
SODIUM ALUMINOSILICATE 4A ZEOLITE
VIEW DETAILS
TAED LUBRIZOL Tetraacetylethylenediamine, Detergent TAED, STOCK AVAILABLE
TAED LUBRIZOL Tetraacetylethylenediami

INR 678 INR 680
You Save 0.29%

VIEW DETAILS
DIETHANOLAMINEused in metalworking fluids for cutting, stamping and die-casting operations as a corrosion inhibitor. In the production of detergents, cleaners, fabric solvents and metalworking fluids, diethanolamine is used for acid neutralization and soil deposition.
DIETHANOLAMINE

INR 978 INR 980
You Save 0.2%

VIEW DETAILS
A thiomalic acid or mercaptosuccinic acid is a dicarboxylic acid containing a thiol functional group. Mercaptosuccinic acid is used in the preparation of mercaptosuccinic acid diethyl ester by reaction with ethanol. It is also used as a brightening agent in metal plating.
Thiomalic acid

INR 358 INR 360
You Save 0.56%

VIEW DETAILS
Sulphamic Acid USESSulphamic acid is used as an acidic cleaning agent, typically for metals and ceramics. It is a replacement for hydrochloric acid for the removal of rust. In households, it is often found as a descaling agent in detergents, cleaners and toilet cleaners for the removal of limescale.
SULPHAMIC ACID

INR 56 INR 58
You Save 3.45%

VIEW DETAILS
Acid slurry manufacturer in drums & carboys, vadodara
Acid slurry

INR 85

VIEW DETAILS
Hydroxylammonium sulfate is used in the production of anti-skinning agents, pharmaceuticals, rubber, textiles, plastics and detergents. It is a radical scavenger that terminates radical polymerization reactions and serves as an antioxidant in natural rubber.
Hydroxylammonium sulfate

INR 91 INR 100
You Save 9%

VIEW DETAILS
Docusate sodium (dioctyl sodium sulfosuccinate) and docusate calcium (dioctyl calcium sulfosuccinate) act like detergents and are used to soften the stool when it is desirable to lessen the discomfort or the strain of defecation. These drugs are anionic surfactants that produce their effect by reducing the surface tension and allowing intestinal fluids and fatty substances to penetrate the fecal mass. They usually require 1 to 3 days to exert their full effect if used alone, but they may be combined with other laxatives in OTC preparations. These agents are not believed to interfere with the absorption of nutrients from the intestinal tract, and they are not appreciably absorbed. Docusate is frequently recommended for elderly patients because it is associated with so few side effects. Diarrhea and mild abdominal cramps are the only adverse effects reported.
Docusate sodium (dioctyl sodium sulfos
VIEW DETAILS
TEEPOL B-300 RECKITT BENCKISER, a liquid detergent multi purpose cleaning detergent for pharmaceutical, chemicals, engineering, food and cosmetic industries.Anionic Surfactant, Teepol B-300 in India Specific Gravity - 1.05 +- 0.05pH - 6 - 8Solubility Completely Soluble in Water ApplicationPharma and Bulk Drug Industry - for cleaning of vessels, utensils, tables, floors and walls.Food, Beverage and Dairy Industry - for multipurpose cleaning cum degreasing of stubborn greasy fat and protein deposits and stains of milk and milk products on aluminum / plastic crates, floors, walls, tables and other food contact surfaces.Shipping Companies - for cleaning of vessels, tanks, floor and walls of containers.
TEEPOL B 300

INR 341 INR 365
You Save 6.58%

VIEW DETAILS
Owing to our experience, we have been successful in catering to the requirements of our esteem clients by offering quality-approved gamut of CBS-X Tinopal. These are acknowledged as a fluorescent whitening agent. Our products are in wide demand of the clients for their use in heavy duty laundry detergents as a brightener for detergent, cotton and linen.Tinopal® CBS-X is a fluorescent whitening agent which absorbs UV radiation and re-emits visible blue light, thus compensating the yellowish appearance of natural fibers. Tinopal® CBS-X has solubility and achieves high level of whiteness and brightness from cold to medium washing temperature, even by short washing time. Application areas:LaundryManufacturing of medicineManufacturing of pesticidesDetergent Whitener, Paper Brightener, Fiber Whitener, Textile Whitener, Color Correction
Tinopal CBS-X

INR 1507 INR 1600
You Save 5.81%

VIEW DETAILS
The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
Zeolite 4A

INR 22 INR 25
You Save 12%

VIEW DETAILS
Sodium Perborate monohydrate, tetrahydrate and coated manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used as a oxidizing agent, bleaching agent, pharmaceuticals. Sodium perborate are used as oxidising and bleaching agents in cleaning, cosmetic and pharmaceutical preparations but their main application is in detergents. Typically a detergent will contain up to 15 wt% of the tetrahydrate and/or up to 10% of the monohydrate.
Sodium Perborate

INR 210

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
Lamesoft PO 65 is preferably used as a lipid layer enhancer for the production of surfactant cleansing preparations.  lipid layer enhancer Lamesoft Po 65.
View Details
Basf Lamesoft Po 65

INR 500

Irgasan DP 300, also known as Triclosan, is a broad-spectrum antimicrobial used in various personal care, hygiene, and healthcare products, including bar soaps, liquid soaps, shower gels, hand washes, deodorants, and acne preparations
View Details
Basf Irgasan Dp 300

INR 1500

BASF Plantapon TF Decyl Glucoside (and) Polyglyceryl-10 Caprylate/Caprate (and) Coco-Glucoside (and) Glyceryl Oleate is a natural, sulfate-free surfactant blend used in mild cleansing products for sensitive skin and baby care. It provides gentle, tear-free cleansing while conditioning the skin and hair, leaving them feeling nourished and smooth. Its gentle cleansing properties make it ideal for various applications, including baby washes, facial cleansers, shampoos, and general body washes
View Details
Basf Plantapon Tf

INR 700

BASF Plantapon LGC Sorb Sodium Lauryl Glucose Carboxylate and Lauryl Glucoside is a mild, anionic surfactant used in personal care products like shampoos, body washes, facial cleansers, liquid hand soaps, and baby care items.
View Details
BASF Plantapon LGC Sorb

INR 700

BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
View Details
Basf Plantacare Series 2

INR 350

BASF Plantapon SF is a mild surfactant mixture used in cosmetic products for personal care, including shampoos, facial washes, baby cleansers, shower gels, and liquid soaps. Having contents Sodium Coco Ampho Acetate & Glycerin &Lauryl Glucoside & Sodium Cocoyl Glutamate & Sodium Lauryl Glucose Carboxylate.
View Details
BASF Plantapon SF

INR 750

BASF Cutina Shine is a plant-derived ingredient used in personal care products for its ability to enhance shine and gloss while providing a rich, creamy texture and mild conditioning
View Details
BASF Cutina Shine

INR 500

BASF's Euperlan PCO is a self-dispersible opacifier used in a variety of personal care products, such as shampoos, liquid soaps, and bath and shower gels, to impart a creamy, white, and dense appearance to the formulations
View Details
BASF's Euperlan PCO

INR 740 INR 750
You Save: INR 10 (1.33%)

BASF Euperlan PK 771 is a cold-processable, surfactant-based pearlizing and refatting agent used in personal care products like shampoos, bubble baths, and body washes to provide a creamy, pearlescent visual effect and a mild, skin-friendly profile. It creates a visually appealing, silky, and dense product appearance, enhancing the overall appeal of these formulations.
View Details
BASF Euperlan PK 771

INR 700

BASF's Cutina EGMS (Glycol Stearate) is a pearlizing and opacifying agent primarily used in personal care products like shampoos, body washes, liquid soaps, and facial cleansers to give them a rich, pearly appearance and improve consistency
View Details
Basf Cutina Egms

INR 750

Sodium Cocoyl IsethionateThis mild surfactant rightly referred to as baby foam, is obtained from coconut oil after undergoing a simple reaction.It is one of the best sulfate-free alternatives available in the market.Owing to its mild cleansing and high foaming capabilities, it is traditionally used to make solid shampoo bars, conditioner bars, syndet bars, and bath bombs.It is outstanding for use in products for color-treated hair.Its peculiarity lies in the fact that it resists hard water and therefore prevents the formation of scum, which ensures no residue is left behind.It lathers pretty well when used as a stand-alone surfactant base and hence appeals to the sense of cleaning.It offers beautiful, gentle “lace glove” lather to our products. It’s also naturally acidic, so it helps our end products have a skin-friendly pH with less (or no) adjusting.
View Details
SCI (Sodium Cocoyl Iseth

INR 145 INR 155
You Save: INR 10 (6.45%)

Sodium Lauryl Ether Sulphate Sles 70%, Available of Godrej Sodium Lauryl Ether Sulphate, SLES Godrej Make, Sles for detergent, Importer of Sodium Lauryl Ether Sulphate Sles 70%.Sodium Lauryl Ether Sulfate (SLES) is a widely used surfactant, primarily in personal care and cleaning products. It's valued for its ability to create foam and lather, making it effective for cleaning and emulsifying.
View Details
Sodium Lauryl Ether Sulp

INR 148

WHITE PHENYL CHEMICALSEmulsifier OP95Pine oil 20% 32Citronella oilRoseLemonMograOrangeLavenderJasminePara Chloro Meta Cresol (PCMC)Para Chloro Meta Xylneol (PCMX)Ortho Benzyl Para Chloro Phenol (OBPCP)
View Details
WHITE PHENYL CHEMICALS

INR 64 INR 65
You Save: INR 1 (1.54%)

Neobor Borax Pentahydrate, Latest imports Neobor Borax Pentahydrate, Neobor Borax Pentahydrate is primarily used for viscosity control in detergents due to its high-quality formulation, acting as a solvent that can also be effective in killing insects and creating a mildly alkaline solution.
View Details
Neobor Borax Pentahydrat

INR 71 INR 72
You Save: INR 1 (1.39%)

ATMP is an effective scale inhibitor used in various industrial applications such as industrial water treatment and detergents.
View Details
Amino Trimethylene Phosp

INR 75 INR 85
You Save: INR 10 (11.76%)

Black Phenyl Raw Materials, Phenyl Raw Materials, Light Creosote oilMono Chloro PhenolPara Chloro Meta Xylenol PCMXRWC BoosterOrtho Benzyl Para Chloro Phenol OBPCPWe have ready stock of Black Phenyl Raw Materials in India.
View Details
Black Phenyl Raw Materia

INR 185 INR 200
You Save: INR 15 (7.5%)

Sodium formate is used in industrial applications and the production of other chemicals. Sodium formate is used in the production of sodium hydrosulfate and formic acid. Sodium formate is also used in leather tanning, printing processes, as a food additive, and as an enzyme stabilizer in detergents.
View Details
Sodium Formate

INR 33 INR 35
You Save: INR 2 (5.71%)

SODIUM ALUMINOSILICATE 4A ZEOLITE MFG. Natural zeolites are analcite, chabazite, natrolite, stilbite, heulandite, and thomsonite. Synthetic production of zeolites implies either a gel process (sodium silicate and alumina) or a clay process (kaolin). Both methods are quite complex, requiring the exchange of various rare-earth oxides. The effectiveness of zeolite depends on its pore size, which may be as small as 4A.
View Details
SODIUM ALUMINOSILICATE 4
TAED LUBRIZOL Tetraacetylethylenediamine, Detergent TAED, STOCK AVAILABLE
View Details
TAED LUBRIZOL Tetraacety

INR 678 INR 680
You Save: INR 2 (0.29%)

DIETHANOLAMINEused in metalworking fluids for cutting, stamping and die-casting operations as a corrosion inhibitor. In the production of detergents, cleaners, fabric solvents and metalworking fluids, diethanolamine is used for acid neutralization and soil deposition.
View Details
DIETHANOLAMINE

INR 978 INR 980
You Save: INR 2 (0.2%)

A thiomalic acid or mercaptosuccinic acid is a dicarboxylic acid containing a thiol functional group. Mercaptosuccinic acid is used in the preparation of mercaptosuccinic acid diethyl ester by reaction with ethanol. It is also used as a brightening agent in metal plating.
View Details
Thiomalic acid

INR 358 INR 360
You Save: INR 2 (0.56%)

Sulphamic Acid USESSulphamic acid is used as an acidic cleaning agent, typically for metals and ceramics. It is a replacement for hydrochloric acid for the removal of rust. In households, it is often found as a descaling agent in detergents, cleaners and toilet cleaners for the removal of limescale.
View Details
SULPHAMIC ACID

INR 56 INR 58
You Save: INR 2 (3.45%)

Acid slurry manufacturer in drums & carboys, vadodara
View Details
Acid slurry

INR 85

Hydroxylammonium sulfate is used in the production of anti-skinning agents, pharmaceuticals, rubber, textiles, plastics and detergents. It is a radical scavenger that terminates radical polymerization reactions and serves as an antioxidant in natural rubber.
View Details
Hydroxylammonium sulfate

INR 91 INR 100
You Save: INR 9 (9%)

Docusate sodium (dioctyl sodium sulfosuccinate) and docusate calcium (dioctyl calcium sulfosuccinate) act like detergents and are used to soften the stool when it is desirable to lessen the discomfort or the strain of defecation. These drugs are anionic surfactants that produce their effect by reducing the surface tension and allowing intestinal fluids and fatty substances to penetrate the fecal mass. They usually require 1 to 3 days to exert their full effect if used alone, but they may be combined with other laxatives in OTC preparations. These agents are not believed to interfere with the absorption of nutrients from the intestinal tract, and they are not appreciably absorbed. Docusate is frequently recommended for elderly patients because it is associated with so few side effects. Diarrhea and mild abdominal cramps are the only adverse effects reported.
View Details
Docusate sodium (dioctyl
TEEPOL B-300 RECKITT BENCKISER, a liquid detergent multi purpose cleaning detergent for pharmaceutical, chemicals, engineering, food and cosmetic industries.Anionic Surfactant, Teepol B-300 in India Specific Gravity - 1.05 +- 0.05pH - 6 - 8Solubility Completely Soluble in Water ApplicationPharma and Bulk Drug Industry - for cleaning of vessels, utensils, tables, floors and walls.Food, Beverage and Dairy Industry - for multipurpose cleaning cum degreasing of stubborn greasy fat and protein deposits and stains of milk and milk products on aluminum / plastic crates, floors, walls, tables and other food contact surfaces.Shipping Companies - for cleaning of vessels, tanks, floor and walls of containers.
View Details
TEEPOL B 300

INR 341 INR 365
You Save: INR 24 (6.58%)

Owing to our experience, we have been successful in catering to the requirements of our esteem clients by offering quality-approved gamut of CBS-X Tinopal. These are acknowledged as a fluorescent whitening agent. Our products are in wide demand of the clients for their use in heavy duty laundry detergents as a brightener for detergent, cotton and linen.Tinopal® CBS-X is a fluorescent whitening agent which absorbs UV radiation and re-emits visible blue light, thus compensating the yellowish appearance of natural fibers. Tinopal® CBS-X has solubility and achieves high level of whiteness and brightness from cold to medium washing temperature, even by short washing time. Application areas:LaundryManufacturing of medicineManufacturing of pesticidesDetergent Whitener, Paper Brightener, Fiber Whitener, Textile Whitener, Color Correction
View Details
Tinopal CBS-X

INR 1507 INR 1600
You Save: INR 93 (5.81%)

The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
View Details
Zeolite 4A

INR 22 INR 25
You Save: INR 3 (12%)

Sodium Perborate monohydrate, tetrahydrate and coated manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used as a oxidizing agent, bleaching agent, pharmaceuticals. Sodium perborate are used as oxidising and bleaching agents in cleaning, cosmetic and pharmaceutical preparations but their main application is in detergents. Typically a detergent will contain up to 15 wt% of the tetrahydrate and/or up to 10% of the monohydrate.
View Details
Sodium Perborate

INR 210

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share