Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
powder
Acetazolamide  pharma api powder available, importer of Acetazolamide  in Vadodara Gujarat India. Call us for latest price.
Acetazolamide  Powder
VIEW DETAILS
Premium Dutch Alkalised Natural Cocoa Powder,Supplier of Premium Dutch Alkalised Natural Cocoa Powder in Vadodara Gujarat India. Please contact for latest price. Premium Dutch Cocoa Powder Suppliers, Natural cocoa powder suppliers in India, Alkalised cocoa powder supplier in Vadodara Gujarat India.
Premium Dutch Alkalised Natural Cocoa
VIEW DETAILS
Red Pouch Dutched Cocoa Powder, 950g, offers a rich, smooth, and intense chocolate flavor, perfect for baking, cooking, and beverages. This premium, alkalized cocoa powder ensures a velvety texture and deep color, enhancing your culinary creations. Ideal for elevating your desserts and drinks with exceptional quality and taste. Red Pouch Dutched Cocoa Powder supplier in Vadodara Mumbai South india, Gujarat India.
Red Pouch Dutched Cocoa Powder

INR 750

VIEW DETAILS
Jindal 201 Cocoa Powder,250g, offers a robust chocolate flavor with a smooth texture, ideal for baking and beverages. Its deep color and rich aroma enhance desserts, hot drinks, and savory dishes. A versatile choice for achieving delicious results in both professional and home kitchens.
Jindal 201 Cocoa Powder
VIEW DETAILS
Jindal 401 Cocoa Powder,250g, provides a balanced chocolate flavor perfect for baking and cooking. Its fine texture and deep color enhance desserts, beverages like hot chocolate, and savory dishes. Ideal for both professional chefs and home cooks seeking quality cocoa powder for diverse culinary creations.
Jindal 401 Cocoa Powder

INR 600

VIEW DETAILS
Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations
Jindal Euro 900 Cocoa Powder
VIEW DETAILS
LUVIGEL EM BASF suppliers,Cosmetic Thickener & Rheology Modifier: Used to thicken various types of emulsions, improving consistency and viscosity, even in cold-process, preservative-free, and high-oil formulations.Emulsifying Agent: Helps mix water and oil phases in emulsions, providing a stable, whiter, and shinier appearance to final products.Skincare Formulations: Ideal for facial creams, lotions, and anti-aging products, providing a fresh, cooling feel and smooth texture.Sun Care & Body Care: Suitable for sunscreen formulations and after-sun products due to its stable, pleasant sensory feel.Hair Styling & Care: Used in hair gels and styling products for improved texture.Decorative Cosmetics: Used in liquid makeup products
LUVIGEL EM BASF
VIEW DETAILS
Alpha-Beta Arteether API (Active Pharmaceutical Ingredient) powder is used to manufacture injectable, fast-acting antimalarial medication. It treats severe, complicated, and chloroquine-resistant malaria
Alpha-Beta Arteether API

INR 9000

VIEW DETAILS
Aceclofenac Active Pharmaceutical Ingredient (API) is used to manufacture finished pharmaceutical products, such as tablets, capsules, gels, and creams, for pain and inflammation relief. As a non-steroidal anti-inflammatory drug. Aceclofenac API Powder stock available.
Aceclofenac API Powder

INR 2500

VIEW DETAILS
BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
Basf Plantacare Series 2000/1200/818/8

INR 350

VIEW DETAILS
Levetiracetam api powder, used in various formulation like tablet, capsules and injection. Levetiracetam used in pharma formulation and raw material in India. You can contact for latest price and COA. Levetiracetam api powder stock available.
Levetiracetam
VIEW DETAILS
Atorvastatin API Powder, Pharma Raw Material API Atorvastatin, stock available Atorvastatin, high quality Atorvastatin api powder.
Atorvastatin
VIEW DETAILS
Ketoconazole IP BP USP API Powder, Stock available ketoconazole, api ketoconazole. Stock Available
Ketoconazole IP BP USP

INR 4600

VIEW DETAILS
Ciprofloxacin IP api powder, api formulation Ciprofloxacin IP, stock Ciprofloxacin IP api, call for Ciprofloxacin IP price.
Ciprofloxacin IP

INR 2500

VIEW DETAILS
Product Name  : 4 Methyl CatecholCAS No. 452-86-2Molecular formula C7H8O2Molcular Weight of  4 Methyl Catechol : 124.144 Methyl Catechol Appearabce :- off white to BrownPhyical Form : 4 Methyl Catechol is Crystalline powder or in flakesMelting point :- 63 C ~ 70 CPurity :- > 95 %
4 Methyl Catechol

INR 1920

VIEW DETAILS
ALLOPURINOL API powder,Pharma raw materials, pharma grade ALLOPURINOL, stock available ALLOPURINOL,
ALLOPURINOL
VIEW DETAILS
ADAPALENE API powder, Pharma raw materials, pharma grade ADAPALENE, stock available ADAPALENE,
ADAPALENE Powder
VIEW DETAILS
MELOXICAM API Powder Manufacturer, Pharma api powder MELOXICAM, Gujarat MELOXICAM Powder, MELOXICAM Baddi Himachal pradesh, MELOXICAM powder manufacturer
MELOXICAM API Powder
VIEW DETAILS
SODIUM ALUMINOSILICATE 4A ZEOLITE MFG. Natural zeolites are analcite, chabazite, natrolite, stilbite, heulandite, and thomsonite. Synthetic production of zeolites implies either a gel process (sodium silicate and alumina) or a clay process (kaolin). Both methods are quite complex, requiring the exchange of various rare-earth oxides. The effectiveness of zeolite depends on its pore size, which may be as small as 4A.
SODIUM ALUMINOSILICATE 4A ZEOLITE
VIEW DETAILS
Nanotechnology Pharma Grade Chemicals, Bio Nano Technology Chemicals, Alumina (Alpha)nanopowderAluminium Titanate NanopowderAminated Graphene Octadecylamine NanopowderBarium Titanate NanopowderBoehmite NanopowderBoron Carbide NanopowderCalcium Carbonate NanopowderCalcium Phosphate NanopowderCarbon Porous NanopowderChitosan NanopowderClay NanopowderCobalt Ferrite NanopowderCopper NanopowderCopper NanowiresCupric Oxide NanopowderDiamond NanopowderFerric Oxide(Alpha)nanopowderFerric Oxide(Gamma)nanopowderFerrous Ferric Oxide NanopowderGraphene Film Super Paper (Gfsp)Graphene Oxide Film Super Paper(Gofsp)Graphite Nanopowder Lubricant GradeMagnetic Iron Oxide Nanocrystals PowderLanthanum Oxide Nanopowder UltrapureNickel NanopowderNickel Titanium Alloy NanopowderPalladium NanopowderPlatinium NanopowderZinc NanopowderZinc Ferric NanopowderZinc Oxide NanopowderZirconium Oxide Nanopowder
NANO POWDER TECH LABORATORY CHEMICALS

INR 1799 INR 1800
You Save 0.06%

VIEW DETAILS
Offering high quality Sodium Selenite Pentahydrate BP, pharma grade Sodium Selenite Pentahydrate BP, feed industry chemicals,medicinal grade Sodium Selenite Pentahydrate BP
Sodium Selenite Pentahydrate BP

INR 1660 INR 1662
You Save 0.12%

VIEW DETAILS
 Piroxicam API, active pharma ingredients, raw materal powder for  Piroxicam API
Piroxicam API

INR 2798 INR 2800
You Save 0.07%

VIEW DETAILS
HEXAMETHONIUM DIBROMIDE pharma raw materials, HEXAMETHONIUM DIBROMIDE powder, medicinal grade HEXAMETHONIUM DIBROMIDE,
HEXAMETHONIUM DIBROMIDE

INR 2198 INR 2200
You Save 0.09%

VIEW DETAILS
Raw Magnesite Lumps, importer of magnesite lumps, stockist of Raw Magnesite Lumps, high quality magnesite power and lumps
Raw Magnesite Lumps

INR 9 INR 12
You Save 25%

VIEW DETAILS
Sulphamic Acid USESSulphamic acid is used as an acidic cleaning agent, typically for metals and ceramics. It is a replacement for hydrochloric acid for the removal of rust. In households, it is often found as a descaling agent in detergents, cleaners and toilet cleaners for the removal of limescale.
SULPHAMIC ACID

INR 56 INR 58
You Save 3.45%

VIEW DETAILS
Offering high quality Sodium Selenite Pentahydrate BP, pharma grade Sodium Selenite Pentahydrate BP, feed industry chemicals, medicinal grade Sodium Selenite Pentahydrate BP
Sodium Selenite Pentahydrate BP

INR 1688 INR 1690
You Save 0.12%

VIEW DETAILS
Silymarin has been used medicinally to treat liver disorders, including acute and chronic viral hepatitis, toxin/drug-induced hepatitis, and cirrhosis and alcoholic liver diseases. It has also been reported to be effective in certain cancers.
Silymarin 70% & 80%
VIEW DETAILS
Calcitonin Salmon, Prednisone Anhydrous, Flupirtine Maleate, Dabigatran Etexilate Mesylate, Atovaquone, Sulindac, Megestrol Acetate, Gemfibrozil, Cefprozil, Ropinirole, Zonisamide, Trazodone, Trimebutine Maleate, Sotalol HCL Betapace AF, Clindamycin Phosphate, Buspirone HCL, Dronedarone, Stavudine, Valsartan, Propafenone HCL, Trimipramine Maleate, Atracurium Besylate, L Alpha GPC, 2 Pyrrolidone, Dimenhydrinate, Thioester, Disopyramide Phosphate
PAT - Pharmaceutical Raw Material Manu
VIEW DETAILS
Offering high quality paracetamol powder, paracetamol BP USP PH EUR grade
Paracetamol Powder
VIEW DETAILS
We offer top-grade Ball Clay Powder, which is used worldwide in the industry of paper, rubber, textile, plastic, and ceramic due to its unique properties such as environment friendly nature, superior density, good particle size and longer shelf life. It is free from flowing powder and highly soluble in water. Hence, the Ball Clay Powder is ideal to be utilized as filler & granulating agent in manufacturing of gypsum granules, DAP, NPK, Soil conditioner, and varied other water soluble Fertilizers.
Ball Clay Powder

INR 18 INR 20
You Save 10%

VIEW DETAILS
Malathion Powder is a NonSystemic insecticide, acaricide with contact,stomach & respiratory action on crops, stored pests.It is an emulsifiable concenterate based on Malathion Tech.that controls household and public health insects/pests viz., Flies,mosquitoes,Cockroaches, bedbugs, ants etc and stored grain pests in warehouses, stores, flies, midges, in animal houses, scairid and phorid flies in Mushrooms ,etc, sucking and chewing insects and spider & mites in a wide range of crops ,including fruits, vines, vegetables, ornamentals, tea, rice, cotton , hops, and glass house crops. in accordance with climatic conditions and approval of local authorities.
MALATHION POWDER

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
Activated Carbon is a porus form of carbon which is manufactured from various carbonaceous raw materials like Pine wood, Coconut shell, Coal, Eucalyptus, Peat, Saw dust, Rice husk, Lignite etc. It is preapered through Carbonisation & Activation of Organic substance. During Carbonisation most of non-carbon elements, Hydrogen, Oxygen are first removed in Gaseous form & it develops the internal pores and then after it is Activated through Chemical Activation or Steam Activation.In Activation process, it increases the numbers & dimensions of Pores & hence it has large internal surface area.Applications of Activated carbon :Air stripper off gasIts purifies carbon dioxideUsed to purity nitrogen in various plastics manufacturing processUsed as a catalyst support and protectorUsed in gasoline vapour recoveryUsed in recovery of various useful solvents which are emitted out as waste gases in various  industriesIn gassifiers to purify the gasesTo remove odors from the air and gasesIt is used in effluent treatment plant to reduce BOD/COD/Color from industrial water.It removes chlorine and organic impurities from drinking water in the last stage filtration in our common house hold filters.It is used as adsorbent of poisonous gases in gas masks for industrial as well as defense purpose.To adsorb moisture from compressed air in paint shopsTo dechlorinate waters in swimming pool and soft drink plantTo remove oil from hot condensateTop quality granular activated carbons are used in the process of gold recovery in which the molten one is passed over a bed of activated carbon where the gold is adsorbed on the carbon and recovered.Used to manufacture catalystRemove of dissolve organic impuritiesBreweries and distilleriesCatalyst carrier in petroleum refineriesIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationIt is used in decolorisation of liquids having impurities with larger pore size i.e sugar solutions, glucose, dextrose,lactose & other starch sugar solutionUsed in decolorisation of vegetable oils and fats and herbal productsIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationAvailable Grades :Pellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbon
Activated Carbon
VIEW DETAILS
Asbestos Powder that we manufacturer is best available quality that anyone can get in India. Our major Product Market is Bharuch, Ankleshwar, Surat, Vadodara, Gujarat , India.. Please Call for best price.We are identified as one of the leading manufacturers, suppliers, wholesalers and exporters of premium quality Asbestos Powder. To provide finest quality, this powder is processed using high quality ingredients that are sourced from certified vendors of the market. We thoroughly check this powder on various parameters like shelf life and precise composition.Features:PurityLonger shelf lifePrecise composition
ASBESTOS POWDER
VIEW DETAILS
Pharma Use Papaverine hydrochloride Crystalline solid grade used in opium alkaloid antispasmodic drug, used primarily in the treatment of visceral spasm and vasospasm (especially those involving the intestines, heart, or brain), and occasionally in the treatment of erectile dysfunction. It is used in the treatment of acute mesenteric ischemia. While it is found in the opium poppy, papaverine differs in both structure and pharmacological action from the analgesic (morphine-related) opium alkaloids (opiates).
Papaverine hydrochloride
VIEW DETAILS
Precision Cut Ultra thin metallic Glitter Particles Consisting of metalized (0.5 aluminum) coated polyester, designed for application requiring maximum brilliance with excellent fastness property, solvent resistance. Formaldehyde Free Glitter Powder for Textiles/cosmetics
Glitter Powder

INR 1768 INR 1790
You Save 1.23%

VIEW DETAILS
We manufacture and supply Best quality of Hydrated Lime Manufacturer, We are vadodara based manufacturer, our Quality analysis department and Research and development department make sure that our quality is superior to our all competitors.Our organization provides a wide assortment of Hydrated Lime Manufacturer, which is widely used for construction purposes. We assure premium quality of our range since, we our quality analysts rigorously check the entire procured line of products. When used as a building material, Hydrated Lime is highly cost-effective. Further, these reduce the reaction time of chemical reactions, owing to its purity.All Grades Hydrated Lime Available in stock ex. Vadodara, Gujarat, India.Application of Hydrated Lime : Construction, ETP, Paint and chemical Industry in India.
Hydrated Lime Powder
VIEW DETAILS
We are one of the oldest & reputed manufacturers & suppliers, exporters of double roasted bentonite granules and powder in India. We manufacture bentonite powder, bentonite blank granules, fire clay powder, imported steam coal powder, etc.Our clients include various Government departments, Foundries, Road Construction, Contractors, Infrastructure, Pilling, Irrigation, Oil drilling companies, etc. throughout India in states like Gujarat, Maharashtra, M.P, A.P, U.P, West Bengal, Tamil Nadu, Assam, Goa, Kerala, etc.We believe in Quality and execution. We always deliver on time with highly competitive prices and this has earned us a good reputation among our clients.SPECIFICATIONS Bentonite:For Drilling Purpose:Drilling GradeOCMA GradeAPI SimpleAPI Section-4For Piling Purpose:Piling GradeSuperior Piling GradeHigh Grade PilingFor Foundry Purpose:Running GradeSuper BondHigh BondEarthing GradeRoasted Bentonite Blank GranulesProperties: Moisture - Max 1%Bulk Density - min - 0.85 gm/ mlAcidity - 0.5% Liquid holding capacity - 15%PH Level - 6.5 to 7.5Size: 10*20, 12*25, 16*35
ROASTED BENTONITE GRANULES
VIEW DETAILS
We are a unique entity in the market, actively committed towards offering an optimum grade of China Clay Powder. Under the stern vigilance of dexterous professionals, our offered powder is processed using premium quality chemical compounds and sophisticated processing techniques. For its accurate composition, our provided powder is widely appreciated among our patrons. Sourced from authentic vendors, quality examiners check this powder against diverse quality parameters to avoid any possible flaws.Major Uses:    PVC cables high voltage insulating materials    Low and medium voltage electric cable insulation    Mechanical rubber goods    Elastomers    PVC    Polyamide    Other plastic / rubber applicationsApplication    Rubber    MB
China Clay Powder
VIEW DETAILS
Owing to our experience, we have been successful in catering to the requirements of our esteem clients by offering quality-approved gamut of CBS-X Tinopal. These are acknowledged as a fluorescent whitening agent. Our products are in wide demand of the clients for their use in heavy duty laundry detergents as a brightener for detergent, cotton and linen.Tinopal® CBS-X is a fluorescent whitening agent which absorbs UV radiation and re-emits visible blue light, thus compensating the yellowish appearance of natural fibers. Tinopal® CBS-X has solubility and achieves high level of whiteness and brightness from cold to medium washing temperature, even by short washing time.	Application areas:LaundryManufacturing of medicineManufacturing of pesticidesDetergent Whitener, Paper Brightener, Fiber Whitener, Textile Whitener, Color Correction
Tinopal CBS-X

INR 1507 INR 1600
You Save 5.81%

VIEW DETAILS
We are one of the prominent manufacturers, exporters and suppliers of high quality Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical. Offered chemical is processed in a very hygienic environment by utilizing quality approved chemical substances. This chemical finds broad applications in cosmetic and soap industry for adding soothing fragrances. Further, this chemical is tested on various quality parameters to ensure its high effectiveness. Besides, our clients can obtain this Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical from us in different packaging options at nominal rates.Application in : Incense Sticks ( Agarbatti ), bakhoor, dhoop & loban, Fine Fragrances & Soap Perfumes, Detergent Powders, Cosmetics & Toiletries.
Yara Yara Beta Naphthyl Methyl Ether

INR 350 INR 360
You Save 2.78%

VIEW DETAILS
Lithium Carbonate Manufacturer Lithium carbonate is an inorganic compound, the lithium salt of carbonate with the formula Li2CO3This white salt is widely used in the processing of metal oxides.For the treatment of bipolar disorder, it is on the World Health Organization's List of Essential Medicines, the most important medications needed in a basic health system.Other names : Dilithium carbonate, Carbolith, Cibalith-S, Duralith, Eskalith, Lithane, Lithizine, Lithobid, Lithonate, Lithotabs Priadel, ZabuyeliteCAS Registry Number: 554-13-2Chemical formula : Li2CO3
Lithium Carbonate
VIEW DETAILS
We are one of the reliable organizations engaged in providing clients with Ferrous Sulphate Powder, which is reckoned for its purity. In this product range, we also offer Ammonium Ferrous Sulphate and Ferrous Sulphate Monohydrate to our clients. The entire range of chemicals offered by us is processed at the vendors' end under hygienic and sterile environment. Clients can avail these chemicals in high-grade packaging of varied quantities, as per the requirement. Price may vary.
Ferrous Sulphate

INR 17 INR 24
You Save 29.17%

VIEW DETAILS
We are the prominent manufacturer, trader & supplier of high grade Bleaching Powder Stable. The offered bleaching powder is processed by our experts utilizing the utmost quality chemical compounds and latest production procedures. This bleaching powder is stringently tested on numerous parameters in order to deliver a perfect range. Our offered bleaching powder is highly appreciated by our renowned clients for its purity & effective quality.
Bleaching Powder
VIEW DETAILS
Buy high quality Natural Bentonite powder, lumps, granules and customized bentonite powder. We are a exporter, manufacturer & supplier of Natural bentonite. Application in - Oil Drilling Industries, mining industry, boiler grade bentonite , pipe line bentonite.
Natural Bentonite
VIEW DETAILS
Buy high quality Halazone powder & tablet manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used in water treatment chemicals, waste water treatment, drinking water treatment.
Halazone
VIEW DETAILS
We are a unique entity in the market, actively committed towards offering an optimum grade of China Clay Powder. Under the stern vigilance of dexterous professionals, our offered powder is processed using premium quality chemical compounds and sophisticated processing techniques. For its accurate composition, our provided powder is widely appreciated among our patrons. Sourced from authentic vendors, quality examiners check this powder against diverse quality parameters to avoid any possible flaws.
China Clay Powder
VIEW DETAILS
Buy high quality SORBITOL 70% liquid & powder manufacturer, supplier, importer, dealer, distributor, trader used in  pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
SORBITOL 70% LIQUID & POWDER
VIEW DETAILS
Buy high quality Acriflavine hydrochloride hcl powder manufacturer, supplier, importer, dealer, distributor, trader used in  pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Acriflavine hydrochloride hcl powder
VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediatefood supplementsbakery chemicalstofu processing chemicalsbone filler chemicalsdental chemicalsorthopedic chemicalsice control chemicalsdust control chemicalsepsom saltssports drinks chemicalsde icing chemicalsindian manufacturerbaddi himachal pradeshPharma Api Powderapi suppliershyderabad benzoic acidmanufacturer intermediatespat impex indiaanti scaling agentzinc chemicalsplant growth regulatormineral oilswater emulsionVadodara Gujarat Indiafluoride chemicalsDimethylaminoethanolDimethyl carbonatemumbai bhiwandi maharashtraDI-N-PROPYLAMINEzeolitesEDTA 4NA LiquidTetrasodium EDTAvadodara vapi ahmedabad suratfumaric acidGAMMA-BUTYROLACTONEMalasiya importerfood glycinepharma glycinecosmetic glycineimporter in indiapat impex glycineGlyoxylic acid 50%Hexylene glycolHydrazine Hydrate 80%Isobutyric acidtextile auxiliariestextile chemicalsdechlorination chemicalsUrsodeoxycholic Acidudca manufacturerGlycerine pitchGlycerine pitch manufacturerGlycerine pitch suppliersGlycerine pitch indiaHydroquinonesuppliers importersIsobutanolMalononitrileMELAMINE CYANURATEelectrical chemicalsMethylcyclohexaneisobutenecoal chemicalsMonoethanolaminesaluminium sulphatenickel chemicalszinc electroplatingconcrete repairglycoltextile coatingsdealer distributoruv coatingscurable coatingsresin raw materialculture mediaculture media baseorganometallic reducing agentchematek synhydrideTert-butyldimethylsilyl chlorideTitanocene dichloridecocoa powdersulphate chemicalsfoam boostermaize starchcapsules chemicalsdisintegrant chemicalscolor removal chemicalsdrying agent chemicalsdehydrating chemicals

INR 1799 INR 1800
You Save: INR 1 (0.06%)

INR 1660 INR 1662
You Save: INR 2 (0.12%)

INR 2798 INR 2800
You Save: INR 2 (0.07%)

INR 2198 INR 2200
You Save: INR 2 (0.09%)

INR 9 INR 12
You Save: INR 3 (25%)

INR 56 INR 58
You Save: INR 2 (3.45%)

INR 1688 INR 1690
You Save: INR 2 (0.12%)

INR 18 INR 20
You Save: INR 2 (10%)

INR 75 INR 80
You Save: INR 5 (6.25%)

INR 1768 INR 1790
You Save: INR 22 (1.23%)

INR 1507 INR 1600
You Save: INR 93 (5.81%)

INR 350 INR 360
You Save: INR 10 (2.78%)

INR 17 INR 24
You Save: INR 7 (29.17%)

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate |food supplements |bakery chemicals |tofu processing chemicals |bone filler chemicals |dental chemicals |orthopedic chemicals |ice control chemicals |dust control chemicals |epsom salts |sports drinks chemicals |de icing chemicals |indian manufacturer |baddi himachal pradesh |Pharma Api Powder |api suppliers |hyderabad benzoic acid |manufacturer intermediates |pat impex india |anti scaling agent |zinc chemicals |plant growth regulator |mineral oils |water emulsion |Vadodara Gujarat India |fluoride chemicals |Dimethylaminoethanol |Dimethyl carbonate |mumbai bhiwandi maharashtra |DI-N-PROPYLAMINE |zeolites |EDTA 4NA Liquid |Tetrasodium EDTA |vadodara vapi ahmedabad surat |fumaric acid |GAMMA-BUTYROLACTONE |Malasiya importer |food glycine |pharma glycine |cosmetic glycine |importer in india |pat impex glycine |Glyoxylic acid 50% |Hexylene glycol |Hydrazine Hydrate 80% |Isobutyric acid |textile auxiliaries |textile chemicals |dechlorination chemicals |Ursodeoxycholic Acid |udca manufacturer |Glycerine pitch |Glycerine pitch manufacturer |Glycerine pitch suppliers |Glycerine pitch india |Hydroquinone |suppliers importers |Isobutanol |Malononitrile |MELAMINE CYANURATE |electrical chemicals |Methylcyclohexane |isobutene |coal chemicals |Monoethanolamines |aluminium sulphate |nickel chemicals |zinc electroplating |concrete repair |glycol |textile coatings |dealer distributor |uv coatings |curable coatings |resin raw material |culture media |culture media base |organometallic reducing agent |chematek synhydride |Tert-butyldimethylsilyl chloride |Titanocene dichloride |cocoa powder |sulphate chemicals |foam booster |maize starch |capsules chemicals |disintegrant chemicals |color removal chemicals |drying agent chemicals |dehydrating chemicals

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us