OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products solvents

Our Manufacturer

solvents
Cyclohexane is used as a solvent, oil extractant, paint and varnish remover, and in solid fuels.
CYCLOHEXANE

INR 120 INR 122
You Save 1.64%

VIEW DETAILS
Dibasic esters (DBE) are versatile chemicals with a wide range of applications, primarily as solvents, plasticizers, and chemical intermediates. They are used in paints, coatings, cleaning products, adhesives, and even in chemical synthesis. Their properties, like low toxicity and biodegradability, make them attractive alternatives to some harsher chemicals.
DIBASIC ESTER
VIEW DETAILS
Butyl Cellosolve Acetate (also known as 2-Butoxyethyl Acetate or Butyl Glycol Acetate) is a versatile solvent with a wide range of applications, primarily in the coatings, printing, and cleaning industries. It is used as a solvent, coalescing agent, and coupling agent in various formulations.
Butyl Cellosolve Acetate

INR 120

VIEW DETAILS
Petroleum Jelly is used as base for ointments, personal care, veterinary and other pharmaceutical and cosmetic applications.Product is offered in HDPE Drums / Steel Drums / IBC and bulk Flexi bags or ISO tanks.
Petroleum Jelly

INR 100

VIEW DETAILS
Tetrabutylammonium AcetateTetrabutylammonium acetate is an organic compound used as a catalyst, solvent, and initiator in many industries. It is used in the synthesis of organic compounds, batteries, solar cells, pigments,
Tetrabutylammonium Acetate

INR 324 INR 325
You Save 0.31%

VIEW DETAILS
Propylene carbonate is a cyclic organic compound with many industrial and technical uses, including:Solvent: It's used as a solvent in paints, inks, nail polish remover, tar remover, and general purpose cleaners. It's also used to capture CO2 and H2S pollutants, dehydrate and sweeten substances, and recover oil and purify gases.
Propylene carbonate Liquid

INR 169 INR 170
You Save 0.59%

VIEW DETAILS
Dipropylene Glycol Dpg ManufacturerChemical intermediate: Used in the production of plastics, plasticizers, and other chemicals Solvent: Used in printing inks, nitrocellulose, cellulose acetate, lacquers, and coatings Fragrance carrier: Used in perfumes, skin and hair care products, and other personal care products Ingredient in cleaners: Used in household and industrial cleaners Agricultural chemical: Used as a solvent for agricultural chemicals such as insecticides Fog fluid: Used in commercial fog fluid in the entertainment industry Extraction solvent: Used in the refining industry to extract aromatics Cutting oil: Used in cutting oils Hydraulic brake fluid: Used in hydraulic brake fluid production Cement grinding aid: Used as a cement grinding aid
Dipropylene Glycol Dpg

INR 249 INR 250
You Save 0.4%

VIEW DETAILS
Tetrabutylammonium bromide (TBAB) is a white powder with a variety of uses, including:Phase transfer catalyst: TBAB is a widely used catalyst for many processes, including alkylation, oxidation, reduction, and esterification. It's also used in the pharmaceutical, agrochemical, polymer, and powder coating industries. Solvent: TBAB can act as a zwitterionic solvent in organic transformations. Reagent: TBAB is used as a reagent for HPLC analysis. Cosmetic ingredient: TBAB is used in cosmetics.
Tetrabutylammonium bromide (TBAB)

INR 380 INR 390
You Save 2.56%

VIEW DETAILS
1,3-Dibromopropane is a chemical compound with many uses, including:Chemical intermediate: Used in the production of a variety of products, such as insecticides, pharmaceuticals, flavoring agents, fragrances, and quaternary ammonium compounds Solvent: Used as a solvent for resins, waxes, and fats Alternative to ozone-depleting solvents: Used as an alternative to chlorofluorocarbons and other ozone-depleting solvents Organic synthesis: Used to form C3-bridged compounds through C-N coupling reactions
1,3-Dibromopropane
VIEW DETAILS
1,4-Dichlorobutane (1,4-DCB) has many uses, including:Raw material: A raw material for drugs, pesticides, fragrances, and chemical fibers Solvent: Used as a solvent Organic synthesis: Used in the synthesis of ligands, coordination polymers, and metal-organic frameworks (MOFs) Natural products: Used as a reagent in the synthesis of natural products such as spiro[4.5]-δ-damascone Nylon 6,6: A precursor for nylon 6,6 via adiponitrile
1,4 Dichlorobutane
VIEW DETAILS
Ortho-chlorotoluene, also known as 1-chloro-2-methyl toluene, is a colorless liquid with a strong, irritating odor. It's used as a solvent, in the production of chemicals, pharmaceuticals, synthetic rubber, and dyes, and as an insecticide and bactericide.
Ortho Chloro Toluene

INR 315 INR 325
You Save 3.08%

VIEW DETAILS
1-Bromohexane (N-hexyl Bromide) manufacturer and suppliers, 1-Bromohexane is used in the production of organic chemicals and pharmaceuticals, and as a solvent in Grignard reactions
1-Bromohexane (N-hexyl Bromide)

INR 490 INR 500
You Save 2%

VIEW DETAILS
DiAcetone Alcohol LiquidDAA is an oxygenated solvent derived from acetone which has two alcohol and ketone functions. It has a high purity. It is colourless and odourless and has a low evaporation rate.
Di Acetone Alcohol Liquid

INR 144 INR 145
You Save 0.69%

VIEW DETAILS
Butyl Glycol Ethers (BGE) are liquid in nature. They can be used in solvent-based coatings, industrial water-based coatings, architectural water-borne coatings, household and industrial cleaners, rust removers, hard surface cleaners, disinfectants, and solvent-based silk screen printing inks.
Butyl Glycol BG

INR 83 INR 85
You Save 2.35%

VIEW DETAILS
Heavy liquid paraffin is a refined mineral oil that is used in cosmetics and pharmaceuticals. It is obtained from petroleum and used for burning in lamps and domestic heaters or furnaces, as a fuel or fuel component for jet engines, and as a solvent for greases and insecticides.
Heavy Liquid Paraffin Hlp

INR 80 INR 85
You Save 5.88%

VIEW DETAILS
N-PROPYL BROMIDE Suppliers,N-Propyl bromide (nPB) or 1-bromopropane, is a solvent that is used in vapor degreasing, metal cleaning, and dry cleaning, as a solvent carrier in adhesives, and as a chemical intermediate.
N-PROPYL BROMIDE

INR 360 INR 460
You Save 21.74%

VIEW DETAILS
1, 6-hexanediol Flakes1,4 Butanediol - Nan Ya2 Butyne 1,4 Diol2 Ethyl Hexyl Acrylate2 Ethylhexanoic Acid2 Hydroxyethyl Methacrylate2 Methyl 1, Propanediol (Mp Diol)2,2-dimethoxy Propane2,4- Dichloro Benzyl Chloride2,4 Pentane Dione (Acetyl Acetone)2-mercaptoethanol2-methyl Thf2-methylimidazole2-pyrrolidone Dist- Basf3-(Dimethylamino) Propylamine4 Hydroxy BenzaldehydeAcetonitrileAcetophenoneAcrylamideAcrylic AcidAdipic AcidAllyl ChlorideAminoethyl EthanolamineAmino Guanidine BicarbAmmonium ThiocyanateAntimony TrioxideBenzoic AcidBhtBisphenol AButyl Carbitol (Db Solvent)Butyl CellosolveButyric AcidCatecholCitric Acid Anhydrous (30-100 Mesh)Citric Acid MonohydrateCyanoacetamideCyclohexylamine.CyclohexaneCyclohexanolCyclohexanoneD (-) Tartaric AcidDeca Bromo Diphenyl EthaneDecabromodiphenyl OxideDi ButylamineDibasic Ester - ChinaDicyandiamideDicyclohexylamineDiethanolamineDiethylamineDiethylenetriamineIsophorone DiamineL (+) Tartaric AcidLithium CarbonateLithium HydroxideMalononitrileMaleic AnhydrideMalonic AcidMelamineMelamine CyanurateMethacrylic AcidMethane Sulfonic AcidMethane Sulfonyl ChlorideMethyl Acrylate - KoreaMethyl CyanoacetateMethyl CyclohexaneMethyl Isobutyl KetoneMethyl Methacrylate MonomerMethyl Tertiary Butyl EtherMethylene ChlorideMono Iso Propanol AmineMonoethanolamineMonoglymeMorpholineN Butyl MethacrylateN Butyric AcidN Methyl PiperazineN PropanolN Propyl AcetateNeopentyl Glycol FlakesN-heptaneNitromethaneOrtho Nitro Aniline 99% MinOrtho Chloro BenzaldehydeOrtho Phosphoric AcidPara Octyl PhenolPara Tertiary Butyl PhenolPara Toluene Sulfonyl ChlorideParaformaldehyde - 96%Paraformaldehyde 91%Pentaerythritol 98%PerchloroethylenePhosphorous AcidPhthalic AnhydridePiperazine AnhydrousPoly Phosphoric Acid 115%Potassium Carbonate -granular/powderPotassium HydroxidePropargyl AlcoholPropionaldehydeAvailable in - New Delhi, Vapi, Ankleshwar, Bangalore, Hyderabad, Chennai, Ahmedabad, Kolkata, Surat, Pune Jaipur, Lucknow, Kanpur, Nagpur, Indore, Visakhapatnam, Thane, Bhopal, Pimpri-Chinchwad, Patna, Vadodara, Ghaziabad, Ludhiana, Coimbatore, Agra, Madurai, Nashik, Faridabad, Meerut, Rajkot, Kalyan-Dombivali, Vasai-Virar, Varanasi, Srinagar, Aurangabad, Dhanbad, Amritsar, Navi Mumbai, Allahabad, Ranchi, Howrah, Jabalpur, Gwalior, Vijayawada, Jodhpur, Raipur, Kota, Guwahati, Chandigarh, Solapur, Hubballi-Dharwad, Tiruchirappalli, Bareilly, Moradabad, Mysore, Tiruppur, Gurgaon, Aligarh, Jalandhar, Bhubaneswar, Salem, Mira-Bhayandar, Warangal, Thiruvananthapuram, Guntur, Bhiwandi, Saharanpur, Gorakhpur, Bikaner, Amravati, Noida, Jamshedpur, Bhilai, Cuttack, Firozabad, Kochi, Nellore, Bhavnagar, Dehradun, Durgapur, Asansol, Nanded, Kolhapur, Ajmer, Gulbarga, Jamnagar, Ujjain, Loni, Siliguri, Jhansi, Ulhasnagar, Jammu, Sangli-Miraj & Kupwad, Mangalore, Erode, Belgaum, Ambattur, Tirunelveli, Malegaon, Gaya, Jalgaon, Udaipur, Maheshtala, Davanagere, Kozhikode, Akola, Kurnool, Rajpur Sonarpur, Rajahmundry, Bokaro, South Dumdum, Bellary, Patiala, Gopalpur, Agartala, Bhagalpur, Muzaffarnagar, Bhatpara, Panihati, Latur, Dhule, Tirupati, Rohtak, Korba, Bhilwara, Berhampur, Muzaffarpur, Ahmednagar, Mathura, Kollam, Avadi, Kadapa, Kamarhati, Bilaspur, Shahjahanpur, Satara, Punjab, Bijapur, Rampur, Shivamogga, Chandrapur, Junagadh, Thrissur, Alwar, Bardhaman, Kulti, Kakinada, Nizamabad, Parbhani, Tumkur, Hisar, Baddi, Mumbai. Andhra Pradesh, Arunachal Pradesh, Assam, Bihar, Chhattisgarh, Goa, Gujarat, Haryana, Himachal Pradesh, Jammu and Kashmir, Jharkhand, Karnataka, Kerala, Madhya Pradesh, Maharashtra, Manipur, Meghalaya, Mizoram, Nagaland, Odisha, Punjab, Rajasthan, Sikkim, Tamil Nadu, Telangana, Tripura, Uttar Pradesh, Uttarakhand, West Bengal, Diu, Daman, Union Territories and Capitals, Andaman and Nicobar Islands, Chandigarh, The Government of NCT of Delhi, Dadra and Nagar Haveli (Silvassa), Lakshadweep, Puducherry. Exporter & Importer in Exporter - Europe, Albania, Andorra, Armenia, Austria, Azerbaijan, Belarus, Belgium, Bosnia and Herzegovina , Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Georgia, Germany, Greece, Hungary, Iceland, Ireland, Italy, Kazakhstan, Kosovo, Latvia, Liechtenstein, Lithuania, Luxembourg, Macedonia, Malta, Moldova, Monaco, Montenegro, Netherlands, Norway, Poland, Portugal, Romania, Russia, San Marino, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland, Turkey, Ukraine, United Kingdom (UK), Vatican City (Holy See), Nigeria, South Africa, Egypt, Algeria, Morocco, Angola, Sudan, Kenya, Ethiopia, Tanzania, Tunisia , DR Congo, Ghana , Libya, Ivory Coast , Cameroon, Uganda , Zambia , Mozambique, Senegal, Zimbabwe , Gabon, Botswana, Namibia, South Sudan, Chad , Mauritius, Burkina Faso, Mali, Equatorial Guinea, Madagascar, Congo, Rwanda, Benin, Niger, Guinea, Malawi, Mauritania, Sierra Leone, Eritrea, Swaziland, Togo, Burundi, Lesotho, Liberia, Djibouti, Cape V
IMPORTER OF CHEMICALS IN INDIA

INR 240 INR 250
You Save 4%

VIEW DETAILS
ETHYLENE DIAMINE chemical liquid,Ethylenediamine is an organic compound that is used as a building block for the production of many other chemical products. It is also used as an excipient in many pharmacological preparations such as creams. Notably, ethylenediamine is a contact sensitizer capable of producing local and generalized reactions
ETHYLENE DIAMINE

INR 497 INR 499
You Save 0.4%

VIEW DETAILS
ETHYL ACETOACETATE solvent Intermediates for pigments, Ethyl acetoacetate is primarily used as a chemical intermediate for the manufacture of pharmaceuticals, pesticides, dyes and pigments.
ETHYL ACETOACETATE

INR 293 INR 295
You Save 0.68%

VIEW DETAILS
Solvent importers, Diisopropyl Ether (DIPE) , Dipe importer, top solvents importer, stock Diisopropyl Ether (DIPE),
Diisopropyl Ether (DIPE)
VIEW DETAILS
Solvent importers, Diisopropyl Ether (DIPE) , Dipe importer, top solvents importer, stock Diisopropyl Ether (DIPE),
Diisopropyl Ether (DIPE)
VIEW DETAILS
2- Methyl Resorcinol 99% (White Powder), Manufacturer of Resorcinol 99 chemicals, stock available in Gujarat-India
2- Methyl Resorcinol 99% (White Powder
VIEW DETAILS
Butyl Cellosolve Korea FranceButyl glycol is most commonly used as a solvent and coalescing agent in water-based paints, coatings and inks where it improves the flow of the products as well as extending their drying time. It is also an efficient flow improver for urea, melamine and phenolic stoving finishes.
Butyl Glycol(Butyl Cellosolve) Korea /

INR 283 INR 285
You Save 0.7%

VIEW DETAILS
Diamino Stilbene Disulfonic Acid (D.A.S.D.A.)Contract manufacturer of Diamino Stilbene Disulfonic Acid, stilbene chemicals
4,4′-Diamino-2,2′-stilbenedisulfonic a
VIEW DETAILS
2-Butynoic Acid (Tetrolic Acid), Tetrolic Acid manufacturer, high quality Tetrolic Acid
2-Butynoic Acid (Tetrolic Acid)

INR 5471 INR 5523
You Save 0.94%

VIEW DETAILS
DIMETHYL SULFOXIDE DMSO, CHEMICAL LIQUID DMSO, DMSO STOCK, IMPORTER OF SULFOXIDE LIQUID CHEMICALS,
DIMETHYL SULFOXIDE DMSO

INR 163 INR 165
You Save 1.21%

VIEW DETAILS
1,4 BUTANEDIOL - DAIREN CHEMICAL CORP, TAIWAN , BUTANEDIOL, SOLVENT BUTANEDIOL IMPORTER,
1,4 BUTANEDIOL - DAIREN CHEMICAL CORP,

INR 78 INR 80
You Save 2.5%

VIEW DETAILS
DIETHANOLAMINEused in metalworking fluids for cutting, stamping and die-casting operations as a corrosion inhibitor. In the production of detergents, cleaners, fabric solvents and metalworking fluids, diethanolamine is used for acid neutralization and soil deposition.
DIETHANOLAMINE

INR 978 INR 980
You Save 0.2%

VIEW DETAILS
2, 2'-Dimercapto Diethyl sulfide, solvents chemicals, importer of 2, 2'-Dimercapto Diethyl sulfide, stock available
2, 2'-Dimercapto Diethyl sulfide (DMDE

INR 648 INR 650
You Save 0.31%

VIEW DETAILS
2-Ethylhexyl acrylate (EHA) Importer, is the ester of acrylic acid and 2-ethyl hexanol. It is used as a raw material to make adhesives, coatings, construction materials, acrylic rubber, and emulsions.
2-Ethylhexyl Acrylate (2-EHA)

INR 248 INR 250
You Save 0.8%

VIEW DETAILS
Imported solvents & chemicals Furfurylamine (FFA)Cyclohexenyl Ethyl Amine(CHEA)5-Chloro-4-Amino-2,1,3– Benzothiadiazole (Intermediate for Tizanidine)Triclabendazole Crude (Stage N-1)2-Furoic Acid3-Hydroxy Pyridine2-Chloro-3-Hydorxy Pyridine2,4-Dichloro AcetophenoneFurfural AlcoholBeta Phenyl Ethyl AmineHydrogen GasFurfuraldehyde (Furfural)2-Furoic Acid Methyl EsterPoly Alylamine HydrochlorideChlorohexanone (6-Chloro-2-Hexanone)Furan
IMPORTED SOLVENTS & CHEMICALS

INR 480 INR 500
You Save 4%

VIEW DETAILS
Thioacetamide ATR organic solvents, importer of Thioacetamide atr,
Thioacetamide (AT-R)

INR 775 INR 800
You Save 3.12%

VIEW DETAILS
DIMETHYLFORMAMIDE DMF is also used as carrier for inks and dyes in various printing and fiber-dying applications. DMF is widely used as a solvent, reagent and catalyst in the synthetic organic chemistry.DIMETHYLFORMAMIDE DMF solvents, importer of DIMETHYLFORMAMIDE, DMF Solvents
DIMETHYLFORMAMIDE

INR 248 INR 250
You Save 0.8%

VIEW DETAILS
Butyl acetate is found in several cosmetic products including as a flavouring solvent in perfumes, in fabrics and leather, in cleaning and care products for vehicles, air, and personal use and as an anticorrosive agent.
BUTYL ACETATE

INR 68 INR 70
You Save 2.86%

VIEW DETAILS
Xylene Sulphur Free solvent available LR grade xylene.
Xylene Sulphur Free
VIEW DETAILS
Isopropyl acetate is a solvent with a wide variety of manufacturing uses that is miscible with most other organic solvents, and moderately soluble in water. It is used as a solvent for cellulose, plastics, oil and fats. It is a component of some printing inks and perfumes.
Isopropyl acetate

INR 150 INR 200
You Save 25%

VIEW DETAILS
2-Methoxypropene is an ether with the chemical formula C4H8O. It is a reagent used in organic synthesis as a protecting group for alcohols, and the conversion diols to the acetonide group.
2-Methoxypropene

INR 730 INR 750
You Save 2.67%

VIEW DETAILS
Contract Manufacturer, suppliers, exporter of Isopropyl Acetate in Vadodara, Ahmedabad, Vapi, Ankleshwar, Gujarat, Maharashtra, India.Isopropyl acetate is a solvent with a wide variety of manufacturing uses that is miscible with most other organic solvents, and moderately soluble in water. It is used as a solvent for cellulose, plastics, oil and fats. It is a component of some printing inks and perfumes.
Isopropyl Acetate

INR 205 INR 225
You Save 8.89%

VIEW DETAILS
Furfuryl alcohol, also called 2-furylmethanol or 2-furancarbinol, is an organic compound containing a furan substitited with a hydroxymethyl group. It is a clear colorless liquid when pure, but becomes amber colored upon prolonged standing. It possesses a faint burning odor and a bitter taste. It is miscible with, but unstable in, water. It is soluble in common organic solvents. Upon treatment with acids, heat and/or catalysts, furfuryl alcohol can be made to polymerize into a resin, poly(furfuryl alcohol).
Furfuryl alcohol
VIEW DETAILS
We are counted as one of the leading suppliers and traders, offering the best quality of Acetone Chemical Compound & Solvents. Due to its accurate composition and longer shelf life, the offered vinyl acetate monomer is highly demanded. Due to our rich vendors’ base and spacious storage facility, our patrons can avail the offered vinyl acetate monomer in bulk quantities, as per their needs and requirements. Features:Compositional accuracyEnhanced shelf lifeHigh density
Acetone

INR 47 INR 52
You Save 9.62%

VIEW DETAILS
Acetone (propanone) is a colorless, flammable liquid, and is the simplest ketone acetone that has high miscibility with water. It serves as an important solvent and typically used for cleaning purposes in the laboratory and also in the production of methyl methacrylate and bisphenol. It is a common building block in organic chemistry. Familiar household uses of Acetone are as the active ingredient in nail polish remover and as paint thinner. Acetone is a good solvent for many plastics and some synthetic fibers as it is used for thinning polyester resin. It is used as one of the volatile components for some paints and varnishes. Acetone is used as a solvent by the pharmaceutical industry and is also used in the production of methyl isobutyl alcohol and methyl isobutyl ketone.
Acetone Propanone
VIEW DETAILS
ISOPROPYL ALCOHOL IPA LIQUID Distilled, Recovered and Pure Grade manufacturer, exporter, importer, supplier. We offer highest purity with quality in drum packing, carboys packing and tanker load packing. We are offering isopropyl alcohol (ipa). iso propyl alcohol(ipa) is a universal name for 2-propanol. It is colorless and flammable with strong odor. This chemical is also referred as rubbing alcohol or iso-propagation. Its chemical formula is c3h8o and is the simplest form of secondary alcohol. It is highly effective and used in various industrial applications.
Isopropyl Alcohol IPA Liquid
VIEW DETAILS
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
Isopropyl Alcohol
VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
Cyclohexane is used as a solvent, oil extractant, paint and varnish remover, and in solid fuels.
View Details
CYCLOHEXANE

INR 120 INR 122
You Save: INR 2 (1.64%)

Dibasic esters (DBE) are versatile chemicals with a wide range of applications, primarily as solvents, plasticizers, and chemical intermediates. They are used in paints, coatings, cleaning products, adhesives, and even in chemical synthesis. Their properties, like low toxicity and biodegradability, make them attractive alternatives to some harsher chemicals.
View Details
DIBASIC ESTER
Butyl Cellosolve Acetate (also known as 2-Butoxyethyl Acetate or Butyl Glycol Acetate) is a versatile solvent with a wide range of applications, primarily in the coatings, printing, and cleaning industries. It is used as a solvent, coalescing agent, and coupling agent in various formulations.
View Details
Butyl Cellosolve Acetate

INR 120

Petroleum Jelly is used as base for ointments, personal care, veterinary and other pharmaceutical and cosmetic applications.Product is offered in HDPE Drums / Steel Drums / IBC and bulk Flexi bags or ISO tanks.
View Details
Petroleum Jelly

INR 100

Tetrabutylammonium AcetateTetrabutylammonium acetate is an organic compound used as a catalyst, solvent, and initiator in many industries. It is used in the synthesis of organic compounds, batteries, solar cells, pigments,
View Details
Tetrabutylammonium Aceta

INR 324 INR 325
You Save: INR 1 (0.31%)

Propylene carbonate is a cyclic organic compound with many industrial and technical uses, including:Solvent: It's used as a solvent in paints, inks, nail polish remover, tar remover, and general purpose cleaners. It's also used to capture CO2 and H2S pollutants, dehydrate and sweeten substances, and recover oil and purify gases.
View Details
Propylene carbonate Liqu

INR 169 INR 170
You Save: INR 1 (0.59%)

Dipropylene Glycol Dpg ManufacturerChemical intermediate: Used in the production of plastics, plasticizers, and other chemicals Solvent: Used in printing inks, nitrocellulose, cellulose acetate, lacquers, and coatings Fragrance carrier: Used in perfumes, skin and hair care products, and other personal care products Ingredient in cleaners: Used in household and industrial cleaners Agricultural chemical: Used as a solvent for agricultural chemicals such as insecticides Fog fluid: Used in commercial fog fluid in the entertainment industry Extraction solvent: Used in the refining industry to extract aromatics Cutting oil: Used in cutting oils Hydraulic brake fluid: Used in hydraulic brake fluid production Cement grinding aid: Used as a cement grinding aid
View Details
Dipropylene Glycol Dpg

INR 249 INR 250
You Save: INR 1 (0.4%)

Tetrabutylammonium bromide (TBAB) is a white powder with a variety of uses, including:Phase transfer catalyst: TBAB is a widely used catalyst for many processes, including alkylation, oxidation, reduction, and esterification. It's also used in the pharmaceutical, agrochemical, polymer, and powder coating industries. Solvent: TBAB can act as a zwitterionic solvent in organic transformations. Reagent: TBAB is used as a reagent for HPLC analysis. Cosmetic ingredient: TBAB is used in cosmetics.
View Details
Tetrabutylammonium bromi

INR 380 INR 390
You Save: INR 10 (2.56%)

1,3-Dibromopropane is a chemical compound with many uses, including:Chemical intermediate: Used in the production of a variety of products, such as insecticides, pharmaceuticals, flavoring agents, fragrances, and quaternary ammonium compounds Solvent: Used as a solvent for resins, waxes, and fats Alternative to ozone-depleting solvents: Used as an alternative to chlorofluorocarbons and other ozone-depleting solvents Organic synthesis: Used to form C3-bridged compounds through C-N coupling reactions
View Details
1,3-Dibromopropane
1,4-Dichlorobutane (1,4-DCB) has many uses, including:Raw material: A raw material for drugs, pesticides, fragrances, and chemical fibers Solvent: Used as a solvent Organic synthesis: Used in the synthesis of ligands, coordination polymers, and metal-organic frameworks (MOFs) Natural products: Used as a reagent in the synthesis of natural products such as spiro[4.5]-δ-damascone Nylon 6,6: A precursor for nylon 6,6 via adiponitrile
View Details
1,4 Dichlorobutane
Ortho-chlorotoluene, also known as 1-chloro-2-methyl toluene, is a colorless liquid with a strong, irritating odor. It's used as a solvent, in the production of chemicals, pharmaceuticals, synthetic rubber, and dyes, and as an insecticide and bactericide.
View Details
Ortho Chloro Toluene

INR 315 INR 325
You Save: INR 10 (3.08%)

1-Bromohexane (N-hexyl Bromide) manufacturer and suppliers, 1-Bromohexane is used in the production of organic chemicals and pharmaceuticals, and as a solvent in Grignard reactions
View Details
1-Bromohexane (N-hexyl

INR 490 INR 500
You Save: INR 10 (2%)

DiAcetone Alcohol LiquidDAA is an oxygenated solvent derived from acetone which has two alcohol and ketone functions. It has a high purity. It is colourless and odourless and has a low evaporation rate.
View Details
Di Acetone Alcohol Liqui

INR 144 INR 145
You Save: INR 1 (0.69%)

Butyl Glycol Ethers (BGE) are liquid in nature. They can be used in solvent-based coatings, industrial water-based coatings, architectural water-borne coatings, household and industrial cleaners, rust removers, hard surface cleaners, disinfectants, and solvent-based silk screen printing inks.
View Details
Butyl Glycol BG

INR 83 INR 85
You Save: INR 2 (2.35%)

Heavy liquid paraffin is a refined mineral oil that is used in cosmetics and pharmaceuticals. It is obtained from petroleum and used for burning in lamps and domestic heaters or furnaces, as a fuel or fuel component for jet engines, and as a solvent for greases and insecticides.
View Details
Heavy Liquid Paraffin Hl

INR 80 INR 85
You Save: INR 5 (5.88%)

N-PROPYL BROMIDE Suppliers,N-Propyl bromide (nPB) or 1-bromopropane, is a solvent that is used in vapor degreasing, metal cleaning, and dry cleaning, as a solvent carrier in adhesives, and as a chemical intermediate.
View Details
N-PROPYL BROMIDE

INR 360 INR 460
You Save: INR 100 (21.74%)

1, 6-hexanediol Flakes1,4 Butanediol - Nan Ya2 Butyne 1,4 Diol2 Ethyl Hexyl Acrylate2 Ethylhexanoic Acid2 Hydroxyethyl Methacrylate2 Methyl 1, Propanediol (Mp Diol)2,2-dimethoxy Propane2,4- Dichloro Benzyl Chloride2,4 Pentane Dione (Acetyl Acetone)2-mercaptoethanol2-methyl Thf2-methylimidazole2-pyrrolidone Dist- Basf3-(Dimethylamino) Propylamine4 Hydroxy BenzaldehydeAcetonitrileAcetophenoneAcrylamideAcrylic AcidAdipic AcidAllyl ChlorideAminoethyl EthanolamineAmino Guanidine BicarbAmmonium ThiocyanateAntimony TrioxideBenzoic AcidBhtBisphenol AButyl Carbitol (Db Solvent)Butyl CellosolveButyric AcidCatecholCitric Acid Anhydrous (30-100 Mesh)Citric Acid MonohydrateCyanoacetamideCyclohexylamine.CyclohexaneCyclohexanolCyclohexanoneD (-) Tartaric AcidDeca Bromo Diphenyl EthaneDecabromodiphenyl OxideDi ButylamineDibasic Ester - ChinaDicyandiamideDicyclohexylamineDiethanolamineDiethylamineDiethylenetriamineIsophorone DiamineL (+) Tartaric AcidLithium CarbonateLithium HydroxideMalononitrileMaleic AnhydrideMalonic AcidMelamineMelamine CyanurateMethacrylic AcidMethane Sulfonic AcidMethane Sulfonyl ChlorideMethyl Acrylate - KoreaMethyl CyanoacetateMethyl CyclohexaneMethyl Isobutyl KetoneMethyl Methacrylate MonomerMethyl Tertiary Butyl EtherMethylene ChlorideMono Iso Propanol AmineMonoethanolamineMonoglymeMorpholineN Butyl MethacrylateN Butyric AcidN Methyl PiperazineN PropanolN Propyl AcetateNeopentyl Glycol FlakesN-heptaneNitromethaneOrtho Nitro Aniline 99% MinOrtho Chloro BenzaldehydeOrtho Phosphoric AcidPara Octyl PhenolPara Tertiary Butyl PhenolPara Toluene Sulfonyl ChlorideParaformaldehyde - 96%Paraformaldehyde 91%Pentaerythritol 98%PerchloroethylenePhosphorous AcidPhthalic AnhydridePiperazine AnhydrousPoly Phosphoric Acid 115%Potassium Carbonate -granular/powderPotassium HydroxidePropargyl AlcoholPropionaldehydeAvailable in - New Delhi, Vapi, Ankleshwar, Bangalore, Hyderabad, Chennai, Ahmedabad, Kolkata, Surat, Pune Jaipur, Lucknow, Kanpur, Nagpur, Indore, Visakhapatnam, Thane, Bhopal, Pimpri-Chinchwad, Patna, Vadodara, Ghaziabad, Ludhiana, Coimbatore, Agra, Madurai, Nashik, Faridabad, Meerut, Rajkot, Kalyan-Dombivali, Vasai-Virar, Varanasi, Srinagar, Aurangabad, Dhanbad, Amritsar, Navi Mumbai, Allahabad, Ranchi, Howrah, Jabalpur, Gwalior, Vijayawada, Jodhpur, Raipur, Kota, Guwahati, Chandigarh, Solapur, Hubballi-Dharwad, Tiruchirappalli, Bareilly, Moradabad, Mysore, Tiruppur, Gurgaon, Aligarh, Jalandhar, Bhubaneswar, Salem, Mira-Bhayandar, Warangal, Thiruvananthapuram, Guntur, Bhiwandi, Saharanpur, Gorakhpur, Bikaner, Amravati, Noida, Jamshedpur, Bhilai, Cuttack, Firozabad, Kochi, Nellore, Bhavnagar, Dehradun, Durgapur, Asansol, Nanded, Kolhapur, Ajmer, Gulbarga, Jamnagar, Ujjain, Loni, Siliguri, Jhansi, Ulhasnagar, Jammu, Sangli-Miraj & Kupwad, Mangalore, Erode, Belgaum, Ambattur, Tirunelveli, Malegaon, Gaya, Jalgaon, Udaipur, Maheshtala, Davanagere, Kozhikode, Akola, Kurnool, Rajpur Sonarpur, Rajahmundry, Bokaro, South Dumdum, Bellary, Patiala, Gopalpur, Agartala, Bhagalpur, Muzaffarnagar, Bhatpara, Panihati, Latur, Dhule, Tirupati, Rohtak, Korba, Bhilwara, Berhampur, Muzaffarpur, Ahmednagar, Mathura, Kollam, Avadi, Kadapa, Kamarhati, Bilaspur, Shahjahanpur, Satara, Punjab, Bijapur, Rampur, Shivamogga, Chandrapur, Junagadh, Thrissur, Alwar, Bardhaman, Kulti, Kakinada, Nizamabad, Parbhani, Tumkur, Hisar, Baddi, Mumbai. Andhra Pradesh, Arunachal Pradesh, Assam, Bihar, Chhattisgarh, Goa, Gujarat, Haryana, Himachal Pradesh, Jammu and Kashmir, Jharkhand, Karnataka, Kerala, Madhya Pradesh, Maharashtra, Manipur, Meghalaya, Mizoram, Nagaland, Odisha, Punjab, Rajasthan, Sikkim, Tamil Nadu, Telangana, Tripura, Uttar Pradesh, Uttarakhand, West Bengal, Diu, Daman, Union Territories and Capitals, Andaman and Nicobar Islands, Chandigarh, The Government of NCT of Delhi, Dadra and Nagar Haveli (Silvassa), Lakshadweep, Puducherry. Exporter & Importer in Exporter - Europe, Albania, Andorra, Armenia, Austria, Azerbaijan, Belarus, Belgium, Bosnia and Herzegovina , Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Georgia, Germany, Greece, Hungary, Iceland, Ireland, Italy, Kazakhstan, Kosovo, Latvia, Liechtenstein, Lithuania, Luxembourg, Macedonia, Malta, Moldova, Monaco, Montenegro, Netherlands, Norway, Poland, Portugal, Romania, Russia, San Marino, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland, Turkey, Ukraine, United Kingdom (UK), Vatican City (Holy See), Nigeria, South Africa, Egypt, Algeria, Morocco, Angola, Sudan, Kenya, Ethiopia, Tanzania, Tunisia , DR Congo, Ghana , Libya, Ivory Coast , Cameroon, Uganda , Zambia , Mozambique, Senegal, Zimbabwe , Gabon, Botswana, Namibia, South Sudan, Chad , Mauritius, Burkina Faso, Mali, Equatorial Guinea, Madagascar, Congo, Rwanda, Benin, Niger, Guinea, Malawi, Mauritania, Sierra Leone, Eritrea, Swaziland, Togo, Burundi, Lesotho, Liberia, Djibouti, Cape V
View Details
IMPORTER OF CHEMICALS IN

INR 240 INR 250
You Save: INR 10 (4%)

ETHYLENE DIAMINE chemical liquid,Ethylenediamine is an organic compound that is used as a building block for the production of many other chemical products. It is also used as an excipient in many pharmacological preparations such as creams. Notably, ethylenediamine is a contact sensitizer capable of producing local and generalized reactions
View Details
ETHYLENE DIAMINE

INR 497 INR 499
You Save: INR 2 (0.4%)

ETHYL ACETOACETATE solvent Intermediates for pigments, Ethyl acetoacetate is primarily used as a chemical intermediate for the manufacture of pharmaceuticals, pesticides, dyes and pigments.
View Details
ETHYL ACETOACETATE

INR 293 INR 295
You Save: INR 2 (0.68%)

Solvent importers, Diisopropyl Ether (DIPE) , Dipe importer, top solvents importer, stock Diisopropyl Ether (DIPE),
View Details
Diisopropyl Ether (DIPE)
Solvent importers, Diisopropyl Ether (DIPE) , Dipe importer, top solvents importer, stock Diisopropyl Ether (DIPE),
View Details
Diisopropyl Ether (DIPE)
2- Methyl Resorcinol 99% (White Powder), Manufacturer of Resorcinol 99 chemicals, stock available in Gujarat-India
View Details
2- Methyl Resorcinol 99%
Butyl Cellosolve Korea FranceButyl glycol is most commonly used as a solvent and coalescing agent in water-based paints, coatings and inks where it improves the flow of the products as well as extending their drying time. It is also an efficient flow improver for urea, melamine and phenolic stoving finishes.
View Details
Butyl Glycol(Butyl Cello

INR 283 INR 285
You Save: INR 2 (0.7%)

Diamino Stilbene Disulfonic Acid (D.A.S.D.A.)Contract manufacturer of Diamino Stilbene Disulfonic Acid, stilbene chemicals
View Details
4,4′-Diamino-2,2′-stilbe
2-Butynoic Acid (Tetrolic Acid), Tetrolic Acid manufacturer, high quality Tetrolic Acid
View Details
2-Butynoic Acid (Tetroli

INR 5471 INR 5523
You Save: INR 52 (0.94%)

DIMETHYL SULFOXIDE DMSO, CHEMICAL LIQUID DMSO, DMSO STOCK, IMPORTER OF SULFOXIDE LIQUID CHEMICALS,
View Details
DIMETHYL SULFOXIDE DMSO

INR 163 INR 165
You Save: INR 2 (1.21%)

1,4 BUTANEDIOL - DAIREN CHEMICAL CORP, TAIWAN , BUTANEDIOL, SOLVENT BUTANEDIOL IMPORTER,
View Details
1,4 BUTANEDIOL - DAIREN

INR 78 INR 80
You Save: INR 2 (2.5%)

DIETHANOLAMINEused in metalworking fluids for cutting, stamping and die-casting operations as a corrosion inhibitor. In the production of detergents, cleaners, fabric solvents and metalworking fluids, diethanolamine is used for acid neutralization and soil deposition.
View Details
DIETHANOLAMINE

INR 978 INR 980
You Save: INR 2 (0.2%)

2, 2'-Dimercapto Diethyl sulfide, solvents chemicals, importer of 2, 2'-Dimercapto Diethyl sulfide, stock available
View Details
2, 2'-Dimercapto Diethyl

INR 648 INR 650
You Save: INR 2 (0.31%)

2-Ethylhexyl acrylate (EHA) Importer, is the ester of acrylic acid and 2-ethyl hexanol. It is used as a raw material to make adhesives, coatings, construction materials, acrylic rubber, and emulsions.
View Details
2-Ethylhexyl Acrylate (2

INR 248 INR 250
You Save: INR 2 (0.8%)

Imported solvents & chemicals Furfurylamine (FFA)Cyclohexenyl Ethyl Amine(CHEA)5-Chloro-4-Amino-2,1,3– Benzothiadiazole (Intermediate for Tizanidine)Triclabendazole Crude (Stage N-1)2-Furoic Acid3-Hydroxy Pyridine2-Chloro-3-Hydorxy Pyridine2,4-Dichloro AcetophenoneFurfural AlcoholBeta Phenyl Ethyl AmineHydrogen GasFurfuraldehyde (Furfural)2-Furoic Acid Methyl EsterPoly Alylamine HydrochlorideChlorohexanone (6-Chloro-2-Hexanone)Furan
View Details
IMPORTED SOLVENTS & CHEM

INR 480 INR 500
You Save: INR 20 (4%)

Thioacetamide ATR organic solvents, importer of Thioacetamide atr,
View Details
Thioacetamide (AT-R)

INR 775 INR 800
You Save: INR 25 (3.12%)

DIMETHYLFORMAMIDE DMF is also used as carrier for inks and dyes in various printing and fiber-dying applications. DMF is widely used as a solvent, reagent and catalyst in the synthetic organic chemistry.DIMETHYLFORMAMIDE DMF solvents, importer of DIMETHYLFORMAMIDE, DMF Solvents
View Details
DIMETHYLFORMAMIDE

INR 248 INR 250
You Save: INR 2 (0.8%)

Butyl acetate is found in several cosmetic products including as a flavouring solvent in perfumes, in fabrics and leather, in cleaning and care products for vehicles, air, and personal use and as an anticorrosive agent.
View Details
BUTYL ACETATE

INR 68 INR 70
You Save: INR 2 (2.86%)

Xylene Sulphur Free solvent available LR grade xylene.
View Details
Xylene Sulphur Free
Isopropyl acetate is a solvent with a wide variety of manufacturing uses that is miscible with most other organic solvents, and moderately soluble in water. It is used as a solvent for cellulose, plastics, oil and fats. It is a component of some printing inks and perfumes.
View Details
Isopropyl acetate

INR 150 INR 200
You Save: INR 50 (25%)

2-Methoxypropene is an ether with the chemical formula C4H8O. It is a reagent used in organic synthesis as a protecting group for alcohols, and the conversion diols to the acetonide group.
View Details
2-Methoxypropene

INR 730 INR 750
You Save: INR 20 (2.67%)

Contract Manufacturer, suppliers, exporter of Isopropyl Acetate in Vadodara, Ahmedabad, Vapi, Ankleshwar, Gujarat, Maharashtra, India.Isopropyl acetate is a solvent with a wide variety of manufacturing uses that is miscible with most other organic solvents, and moderately soluble in water. It is used as a solvent for cellulose, plastics, oil and fats. It is a component of some printing inks and perfumes.
View Details
Isopropyl Acetate

INR 205 INR 225
You Save: INR 20 (8.89%)

Furfuryl alcohol, also called 2-furylmethanol or 2-furancarbinol, is an organic compound containing a furan substitited with a hydroxymethyl group. It is a clear colorless liquid when pure, but becomes amber colored upon prolonged standing. It possesses a faint burning odor and a bitter taste. It is miscible with, but unstable in, water. It is soluble in common organic solvents. Upon treatment with acids, heat and/or catalysts, furfuryl alcohol can be made to polymerize into a resin, poly(furfuryl alcohol).
View Details
Furfuryl alcohol
We are counted as one of the leading suppliers and traders, offering the best quality of Acetone Chemical Compound & Solvents. Due to its accurate composition and longer shelf life, the offered vinyl acetate monomer is highly demanded. Due to our rich vendors’ base and spacious storage facility, our patrons can avail the offered vinyl acetate monomer in bulk quantities, as per their needs and requirements. Features:Compositional accuracyEnhanced shelf lifeHigh density
View Details
Acetone

INR 47 INR 52
You Save: INR 5 (9.62%)

Acetone (propanone) is a colorless, flammable liquid, and is the simplest ketone acetone that has high miscibility with water. It serves as an important solvent and typically used for cleaning purposes in the laboratory and also in the production of methyl methacrylate and bisphenol. It is a common building block in organic chemistry. Familiar household uses of Acetone are as the active ingredient in nail polish remover and as paint thinner. Acetone is a good solvent for many plastics and some synthetic fibers as it is used for thinning polyester resin. It is used as one of the volatile components for some paints and varnishes. Acetone is used as a solvent by the pharmaceutical industry and is also used in the production of methyl isobutyl alcohol and methyl isobutyl ketone.
View Details
Acetone Propanone
ISOPROPYL ALCOHOL IPA LIQUID Distilled, Recovered and Pure Grade manufacturer, exporter, importer, supplier. We offer highest purity with quality in drum packing, carboys packing and tanker load packing. We are offering isopropyl alcohol (ipa). iso propyl alcohol(ipa) is a universal name for 2-propanol. It is colorless and flammable with strong odor. This chemical is also referred as rubbing alcohol or iso-propagation. Its chemical formula is c3h8o and is the simplest form of secondary alcohol. It is highly effective and used in various industrial applications.
View Details
Isopropyl Alcohol IPA Li
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
View Details
Isopropyl Alcohol

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share