Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
industry
Pregelatinized starch stock available, Pregelatinized starch used in Pharmaceuticals Excipient, food industry, Adhesives binders and construction uses. Call for price.
Pregelatinized starch
VIEW DETAILS
Vitamin A Palmitate 1.7 miu best for food industry, personal care products manufacturing and cosmetic industry. Best for pharma formulation and other pharma additives.
Vitamin A Palmitate 1.7 miu
VIEW DETAILS
Tetrahydrofurfuryl methacrylate (THFMA) is a versatile biobased monomer used to produce high-performance polymers, coatings, adhesives, and sealants, often favored for enhancing flexibility and strength.
Tetrahydrofurfuryl methacrylate (THFMA
VIEW DETAILS
4-Hydroxybutyl acrylate (4-HBA) is a monofunctional monomer primarily used to produce high-performance acrylic resins, UV/EB-curable inks, coatings, and adhesives
4-Hydroxybutyl acrylate
VIEW DETAILS
Methoxy propanol acetate (PMA or PGMEA) is a versatile, low-toxicity, and biodegradable industrial solvent with a mild odor, primarily used as a solvent for paints, inks, and resins
Methoxy propanol acetate
VIEW DETAILS
1,6-Hexanediol Diacrylate (HDDA) is a difunctional monomer widely used as a reactive diluent and crosslinking agent in UV/EB-curable coatings, inks, and adhesives. It offers low viscosity, fast curing, and enhances chemical/abrasion resistance, hardness, and flexibility in products. Key uses include 3D printing, electronics, textiles, and optical fibers.
1,6-Hexanediol Diacrylate (HDDA)
VIEW DETAILS
Methoxy propanol (Propylene Glycol Methyl Ether/PGM) is a versatile, low-toxicity, low-viscosity solvent utilized primarily in paints, inks, cleaning products, and electronics
Methoxy propanol
VIEW DETAILS
2-Methoxyethyl acrylate (MTA) is a specialty monomer used to produce polymers, coatings, adhesives, and paints.
2-Methoxyethyl acrylate
VIEW DETAILS
Isobutyl methacrylate (IBMA) is a versatile functional monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants.
Isobutyl methacrylate (IBMA)
VIEW DETAILS
Neopentyl glycol (NPG) is a crucial intermediate used primarily in the production of high-performance saturated polyester resins, powder coatings, and alkyd resins, enhancing durability, weathering, and corrosion resistance. Its key uses include automotive coatings, industrial lubricants, synthetic ester lubricants, plasticizers, and unsaturated polyesters (UPR) for composite materials
Neopentyl glycol (NPG)
VIEW DETAILS
Monopropylene glycol (MPG) is a versatile, low-toxicity chemical used primarily as an industrial antifreeze/coolant, a solvent for pharmaceuticals and cosmetics, and a stabilizer in food products.
Monopropylene glycol (MPG)
VIEW DETAILS
Ethyl glycol acetate (EGA) is a high-performance solvent used primarily in surface coatings, printing inks, and paints due to its slow evaporation rate and excellent dissolving power for resins like acrylic, nitrocellulose, and epoxy. It serves as a coalescing agent for coatings and as a solvent for industrial cleaning.
Ethyl glycol acetate (2-ethoxyethyl ac
VIEW DETAILS
3-Ethyl-3-oxetanemethanol (CAS 3047-32-3) is a versatile UV-curable monomer and reactive diluent used primarily in UV-curable inks, coatings, and adhesives. It acts as a specialized chemical intermediate for producing hyperbranched polyethers, pharmaceuticals, and advanced materials requiring improved flexibility, chemical resistance, and cationic polymerization properties.
3 ethyl 3 oxetanemethanol
VIEW DETAILS
N-butanol (1-butanol) is a versatile, four-carbon industrial alcohol primarily used as a solvent in paints, coatings, varnishes, and resins, and as a chemical intermediate to produce butyl acrylate, butyl acetate, and plasticizers. It is also used in pharmaceuticals (extractant), personal care products, hydraulic fluids, and as a potential biofuel
N Butanol
VIEW DETAILS
Jeffamine D-230 is a low-viscosity, polyether diamine primarily used as a high-performance curing agent for epoxy resins to produce tough, clear, and impact-resistant coatings, adhesives, and composites. It is widely used in polyurea systems, polyurethane chain extension, and in industrial coatings, fillers, and amine neutralizers for paints.
Jeffamine D-230

INR 100

VIEW DETAILS
Polyethylene Glycol (200) Diacrylate (PEG200DA) is a low-viscosity, fast-curing, bifunctional monomer used primarily as a reactive diluent, crosslinking agent, and binder in UV-curable coatings, inks, adhesives, and electronics.
POLYETHYLENE GLYCOL(200) DIACRYLATE (P
VIEW DETAILS
Benfotiamine IH is primarily used in dietary supplements for its ability to support and maintain healthy nerve function. Its high level of purity and solubility in water facilitates its use in various supplement formulations intended for adult wellness.
Benfotiamine IH
VIEW DETAILS
Sodium cyclamate is a non-nutritive, high-intensity, heat-stable artificial sweetener used primarily in low-calorie foods, beverages, tabletop sweeteners, pharmaceuticals, and cosmetics, being 30-50 times sweeter than sugar. It is commonly used in combination with other sweeteners like saccharin to mask aftertastesFood and Beverage Industry: Used in diet sodas, canned fruits, jams, jellies, desserts, yogurt, and candies. It is particularly favored for its stability under heat, making it suitable for baking and cooking.Tabletop Sweeteners: Used in powder, tablet, or liquid forms for coffee, tea, and home use.Pharmaceuticals: Applied in medicines, such as oral liquids, syrups, and lozenges, to mask bitter tastes and improve patient compliance.Personal Care Products: Included in toothpaste, mouthwash, and lip gloss for a sweet taste without causing tooth decay.Industrial/Other Uses: Used in certain specialty products, such as fragrant coatings.
Sodium cyclamate
VIEW DETAILS
L-phenylalanine is an essential amino acid that the human body cannot produce on its own and must be obtained through diet or supplements. It is primarily found in protein-rich foods like meat, fish, eggs, and dairy. Stock Available L-phenylalanine in Vadodara Gujarat India.
L-phenylalanine
VIEW DETAILS
L-carnitine L–tartrate powderIt helps the body turn fat into energy. L-carnitine is important for heart and brain function, muscle.
L-carnitine L–tartrate powder
VIEW DETAILS
Key applications of TDI 80/20 include:Flexible Polyurethane Foam: The primary use is in manufacturing soft foams for upholstery, mattresses, pillows, and automotive seating.Coatings and Varnishes: Used in producing durable, high-performance coatings, particularly for wood, metal, and automotive applications.Adhesives and Sealants: Employed to create strong bonding materials for construction and industrial use.Elastomers: Used to produce specialized, durable elastomers like wheels, gaskets, and seals.Specialty Applications: Applied in packaging materials, technical insulating foams, and specialized items like toy molding
Toluene Diisocyanate (TDI 80/20)

INR 220

VIEW DETAILS
N-Butyl Methacrylate (nBMA) is a versatile, hydrophobic monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants, offering flexibility, durability, and UV/water resistance. It serves as a plasticizing co-monomer in automotive coatings, industrial paints, textile/leather finishing, dental materials, and oil additives
N BUTYL METHACRYLATE
VIEW DETAILS
MONO ISOPROPANOL AMINE uses in intermediate, neutralizer, emulsifier, and stabilizer in industries like personal care, agrochemicals, coatings, and metalworking. It is primarily used for pH adjustment, anticorrosion, fatty acid neutralization, and synthesizing surfactants, pharmaceuticals, and polyurethane
MONO ISOPROPANOL AMINE

INR 250

VIEW DETAILS
Methylcyclohexane (MCH) is a versatile solvent and chemical intermediate used extensively in industrial processes, such as for paints, coatings, adhesives, and cleaning agents due to its ability to dissolve hydrophobic materials. It acts as a jet fuel component/surrogate and in refining to produce toluene
Methylcyclohexane MCH

INR 165

VIEW DETAILS
Isobutanol (2-methyl-1-propanol) is a versatile chemical used primarily as an industrial solvent, chemical intermediate, and biofuel additive. Key applications include manufacturing paints, coatings, lacquers, and varnishes to prevent blushing, acting as a raw material for plastics, rubber, and esters like isobutyl acetate, and serving as a high-octane, low-corrosion additive in fuels.
ISO BUTANOL

INR 98

VIEW DETAILS
GAMMA-BUTYROLACTONE GBL is a commonly used industrial chemical intermediate and solvent, which is found in paint removers, cleaners, adhesives, and nail polish removers
GAMMA-BUTYROLACTONE

INR 2500

VIEW DETAILS
Dimethylaminoethanol (DMAE) has diverse uses as a key chemical in coatings/paints (curing epoxy/polyurethane resins), water treatment (corrosion/scale inhibitor), and as an intermediate for pharmaceuticals, dyes, and emulsifiers
Dimethylaminoethanol (DMAE)

INR 220

VIEW DETAILS
Phenoxyethanol is a solvent for resins and an improving agent for paints, printing inks, and ballpoint pens. Phenoxyethanol is also used as a bactericide in detergents and a film-forming aid for water-based coatings. Additionally, phenoxyethanol serves as an anesthetic and fixative in perfumes.
2 Phenoxyethanol Liquid

INR 175

VIEW DETAILS
Zinc phosphate is used in metal finishing as a corrosion-resistant coating, and in paints to enhance adhesion and prevent corrosion. It is also used in dentistry as a cement to bond dental restorations to teeth. Other applications include fertilizers for plants, water treatment products, as an anti-scaling agent, and in the production of rubber goods
Zinc Phosphate

INR 190

VIEW DETAILS
Copper sulfate pentahydrate is a blue crystalline salt used as a fungicide and algaecide in agriculture and water treatment, an additive in animal feed and supplements, and in the production of other copper compounds, dyes, and alloys. All grades of Copper Sulphate Pentahydrate ACS AR LR IP BP USP Food Grade available in Stock.
Copper Sulphate Pentahydrate ACS AR LR

INR 225

VIEW DETAILS
Calcium Sulphate Dihydrate BP IP USP LR ACS Food Grade is used as a pharmaceutical excipient in tablets and capsules, a bone filler in orthopedic and dental applications, and as a food additive and processing aid for products like tofu. It also serves as a soil amendment in agriculture, improves soil structure, and provides calcium and sulfur.
Calcium Sulphate Dihydrate BP IP USP L

INR 190

VIEW DETAILS
Tri sodium citrate, also known as sodium citrate, has a wide range of uses due to its buffering, emulsifying, and sequestrant properties. It's commonly used as a food additive, in cleaning products, and even in medicine
Tri Sodium Citrate

INR 110

VIEW DETAILS
Calcium citrate malate (CCM) is primarily used to prevent or treat calcium deficiency and support bone health. It's a highly bioavailable form of calcium, meaning it's easily absorbed by the body, even on an empty stomach.
Calcium Citrate Malate

INR 190

VIEW DETAILS
Dihydrate Ammonium Citrate Powder is a versatile chemical compound with uses in pharmaceuticals, food & beverage, and industrial applications. In pharmaceuticals, it can be used as a buffering agent, chelating agent, and a source of nitrogen in supplements. It's also used in rust-proofing, cotton printing, and as a plasticizer. In food and beverage, it can act as a buffering agent and emulsifying agent. Industrially, it's used in water treatment, metal cleaning, and as a ceramic dispersing agent.
Dihydrate Ammonium Citrate Powder

INR 250

VIEW DETAILS
TALL OIL FATTY ACID (TOFA) is used in a variety of industries due to its surfactant, emulsifying, and adhesive properties. Specifically, it's used in paints and coatings, lubricants and metalworking fluids, adhesives and surfactants, and the rubber and tire industry.
TALL OIL FATTY ACID (TOFA)

INR 133 INR 135
You Save 1.48%

VIEW DETAILS
EDTA 2 NA-DISODIUM ETHYLENE DIAMINE suppliers, High quality EDTA 2 NA-DISODIUM ETHYLENE DIAMINE available in stock, Call for latest price.
EDTA 2 NA-DISODIUM ETHYLENE DIAMINE

INR 190

VIEW DETAILS
Dibasic esters (DBE) are versatile chemicals with a wide range of applications, primarily as solvents, plasticizers, and chemical intermediates. They are used in paints, coatings, cleaning products, adhesives, and even in chemical synthesis. Their properties, like low toxicity and biodegradability, make them attractive alternatives to some harsher chemicals.
DIBASIC ESTER
VIEW DETAILS
Butyl Cellosolve Acetate (also known as 2-Butoxyethyl Acetate or Butyl Glycol Acetate) is a versatile solvent with a wide range of applications, primarily in the coatings, printing, and cleaning industries. It is used as a solvent, coalescing agent, and coupling agent in various formulations.
Butyl Cellosolve Acetate

INR 120

VIEW DETAILS
Stock Available Nutraceutical Baddi Himachal Pradesh India Nutraceutical IP BP USPAspartateCalcium AspartateCopper AspartateMagnesium Aspartate EPPotassium  AspartateAcetatePotassium Acetate USP EPSodium Acetate Trihydrate IP BP USPMagnesium AcetateZinc AcetateCarbonate & Bi CarbonatesCalcium Carbonate IP BP USPSodium Carbonate Anhydrous IP BP USP NFSodium Carbonate Monohydrate IP BP USP NFPotassium CarbonateZinc Carbonate USPSodium Bicarbonate IP BP USPChlorideBarium Chloride IP BP USPCalcium Chloride Dihydrate IP BP USPMagnesium Chloride Hexahydrate IP BP USPPotassium Chloride IP BP USPSodium Chloride IP BP USPLactateMagnesium Lactate Dihydrate BP/EPCalcium Lactate IP BP USPNitrate & NitritePotassium Nitrate BP IP USPSodium Nitrite USP BP IPStearateCalcium Stearate IP BP USPMagnesium Stearate IP BP USPOrotatesCalcium Orotate Dihydrate BPOxideMagnesium Oxide IP BP USP EPSpeciality ChemicalsBoric Acid Citric Acid Monohydrate IP BP USPCitric Acid Anhydrous IP BP USPEdetate Disodium Dihydrate IP BP USPCalcium Disodium EdetatePotassium BenzoateTartaric Acid IP BP USPUrea IP BP USPBenzoic Acid IP BP USPChromium Picolinate USPCalcium Propionate USPMagnesium Peroxide BPIodoform USP NFCitrateCalcium Citrate USPFerric Ammonium Citrate IP BP USPPotassium Citrate IP BP USPSodium Citrate Tribasic IP BP USPMagnesium Citrate USPPotassium Magnesium CitrateZinc Citrate USPFumrateFerrous Fumarate IP BP USPGluconateCalcium Gluconate IP BP USPCopper Gluconate USP IP BPFerrous Gluconate IP BP USPMagnesium Gluconate BP IP USPManganese Gluconate BP IP USPPotassium Gluconate USPSodium SitboGluconate IP BP USPSodium Gluconate USPZinc Gluconate IP BP USPGlycinateGlycine IP BP USP EPIodide & IodatePotassium Iodate IP BP USPLevulinatesCalcium Levulinate IP BP USPPhosphateCalcium Phosphate Dibasic DihydrateMagnesium PhosphateSodium Phosphate GPPotassium PhosphateSeleniteSodium Selenite Pentahydrate BPSulphate & SulphiteAmmonium Sulphate IP BP USPBarium Sulphate IP BP USPCopper Sulphate pentahydrate anhydrous BPCopper Sulphate USPFerrous Sulphate Dried IP BP USPMagnesium Sulphate Monohydrate IPMagnesium Sulphate Anhydrous IP BP USPMagnesium Sulphate Dried IP BP USPSodium Sulphate USPPotassium Sulphate IP BPManganese Sulphate Monohydrate BP USPCalcium Sulphate USPCalcium Sulphate Dihydrate USPPotassium Hydrogen Sulphate USPSodium Sulphite USPNew ProductsCalcium D SaccharateFerric PyrophosphateNew ProductsBoron CitrateBoron GlycinateCalcium Lactate GluconateMagnesium TaurateMagnesium Acetyl TaurateMagnesium Citrate DC Grade Soluble Magnesium Bisglycinate 10% SolubleZinc LactateZinc PicolinateMagnesium Chloride Aquaculture Grade
Baddi Nutraceutical Chemicals

INR 250

VIEW DETAILS
Aquarius Preferred HSC, Aquarius Preferred HSP, Aquarius Prime, Aquarius Prime LS, Aquarius PVA, Cellulose Polymers, Copovidone with Cellulosic Polymers. HPMC and lactose based film coating systems, sprayable at up to 20% w/w solids.High-solids coatings.High-solids coatings for significant improvements in adhesion and sprayable solids.Good film strength and moderate film adhesion.Significant improvement in film adhesion.Moisture and oxygen barrier properties
Ready Mix Coating
VIEW DETAILS
Copovidone Plasdone S 630, Plasdone S 630 Ultra stock available used in Used as a dry binder aid in granulation and matrix Plasdone S 630 Ultra	Low peroxide content, K value viscosity 25.0-31.0 polymer for solid dispersion formulations. It is used to enhance solubility of poorly water soluble drugs through hot melt extrusion or spray dried solid dispersions
Copovidone
VIEW DETAILS
Super Disintegrants and Lubricants additives FARMAL CCS Croscarmellose SodiumFARMAL SSG P Sodium Starch glycolate PotatoFARMAL SSG C (Sodium Starch glycolate CornFARMAL CCMC Calcium Carboxymethyl CelluloseFARMAL MGS Magnesium Stearate Lubricant Silver Sulfadiazine LubricantSuperior dissolution and disintegrant for pharmaceutical formulations like tablets and capsulesTablet and capsule disintegrant retains its disintegrating efficiency even if it is in close proximity of hydrophobic excipientsCoating agent, tablet binder, suspending agent, waterabsorbing agent, viscosity-increasing agent, stabilizing agent, and the disintegration of tablets and capsulesMost frequently used as a lubricant in compressed tablets, capsules. Prolonged drug liberation time, decrease in hardness, increase in disintegration time. In topical formulation like creams, for treatment of severe burns
Super Disintegrants and Lubricants
VIEW DETAILS
N Acetyl L Cysteine importers, N-acetyl cysteine high quality importers, please contact for latest price and COA.
N Acetyl L Cysteine
VIEW DETAILS
Basf Nutrilan Milk Hydrolyzed Milk Protein, Food chemicals, stock available Basf Nutrilan Milk Hydrolyzed Milk Protein,
Basf Nutrilan Milk Hydrolyzed Milk Pro
VIEW DETAILS
METHACRYLIC ACID (MAA) in India,Mainly used in paints, adhesives, and leather treatment agents, methacrylic acid is also used as a raw material in the manufacture of ion-exchange resins.
METHACRYLIC ACID (MAA)

INR 304 INR 306
You Save 0.65%

VIEW DETAILS
2,3,5 Trimethyl Pyrazine, It comes from baked food, fried barley, potatoes, and peanuts. 2,3,5-Trimethylpyrazine is used for the flavor in cocoa, coffee, chocolate, potato, cereal, and fried nuts.
2,3,5 Trimethyl Pyrazine

INR 240 INR 250
You Save 4%

VIEW DETAILS
Trimethyl Ortho Acetate,Mainly used as chemical intermediate of pharmaceutical and agricultural chemicals. Used for compound medical intermediates of vitamin B1, vitamin A1 and sulfanilamide. Used in dye and spices industry, Medicine, agricultural chemicals and as paint additives
Trimethyl Ortho Acetate

INR 1590 INR 1600
You Save 0.62%

VIEW DETAILS
sulphonated Naphthalene Formaldehyde Powdersulphonated Naphthalene Formaldehyde liquid available in stock in Vadodara Gujarat India sulphonated Naphthalene Formaldehyde Powder
Sulphonated Naphthalene Formaldehyde

INR 70 INR 80
You Save 12.5%

VIEW DETAILS
Butyl Glycol Ethers (BGE) are liquid in nature. They can be used in solvent-based coatings, industrial water-based coatings, architectural water-borne coatings, household and industrial cleaners, rust removers, hard surface cleaners, disinfectants, and solvent-based silk screen printing inks.
Butyl Glycol BG

INR 83 INR 85
You Save 2.35%

VIEW DETAILS
BASF make Tinuvin light stabilizer for paint and coating industry in India,The purpose of TINUVIN performance additives for UV protection and durability is to safeguard coatings and increase their lifespan. Ultraviolet Light Absorbers (UVA) and Hindered-Amine Light Stabilizers (HALS) are the two categories of light stabilizers in our repertoire. There are various commercially available forms of UVA depending on the sort of light-absorbing unit. Spectral coverage is widest with benzotriazoles.We have available stock of BASF Tinuvin SeriesTinuvin 292Tinuvin 1130Tinuvin 5151Tinuvin 5050Tinuvin 328Tinuvin 400Tinuvin 5341Tinuvin cgl 5bImportant attributes and advantagesprolonged durability of UV-sensitive materialsImproved color constancyincreased resilience of adhesives and coatingsApplicationAutomotive coatingsBuilding materialsConstruction coatingsElastomeric roof coatingsFurniture and wood coatingsIndustrial coatingsMarine coatingsOverprint varnish (OPV)Printing and packaging
BASF TINUVIN

INR 190 INR 200
You Save 5%

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediatefood supplementsbakery chemicalstofu processing chemicalsbone filler chemicalsdental chemicalsorthopedic chemicalsice control chemicalsdust control chemicalsepsom saltssports drinks chemicalsde icing chemicalsindian manufacturerbaddi himachal pradeshPharma Api Powderapi suppliershyderabad benzoic acidmanufacturer intermediatespat impex indiaanti scaling agentzinc chemicalsplant growth regulatormineral oilswater emulsionVadodara Gujarat Indiafluoride chemicalsDimethylaminoethanolDimethyl carbonatemumbai bhiwandi maharashtraDI-N-PROPYLAMINEzeolitesEDTA 4NA LiquidTetrasodium EDTAvadodara vapi ahmedabad suratfumaric acidGAMMA-BUTYROLACTONEMalasiya importerfood glycinepharma glycinecosmetic glycineimporter in indiapat impex glycineGlyoxylic acid 50%Hexylene glycolHydrazine Hydrate 80%Isobutyric acidtextile auxiliariestextile chemicalsdechlorination chemicalsUrsodeoxycholic Acidudca manufacturerGlycerine pitchGlycerine pitch manufacturerGlycerine pitch suppliersGlycerine pitch indiaHydroquinonesuppliers importersIsobutanolMalononitrileMELAMINE CYANURATEelectrical chemicalsMethylcyclohexaneisobutenecoal chemicalsMonoethanolaminesaluminium sulphatenickel chemicalszinc electroplatingconcrete repairglycoltextile coatingsdealer distributoruv coatingscurable coatings

INR 133 INR 135
You Save: INR 2 (1.48%)

INR 304 INR 306
You Save: INR 2 (0.65%)

INR 240 INR 250
You Save: INR 10 (4%)

INR 1590 INR 1600
You Save: INR 10 (0.62%)

INR 70 INR 80
You Save: INR 10 (12.5%)

INR 83 INR 85
You Save: INR 2 (2.35%)

INR 190 INR 200
You Save: INR 10 (5%)

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate |food supplements |bakery chemicals |tofu processing chemicals |bone filler chemicals |dental chemicals |orthopedic chemicals |ice control chemicals |dust control chemicals |epsom salts |sports drinks chemicals |de icing chemicals |indian manufacturer |baddi himachal pradesh |Pharma Api Powder |api suppliers |hyderabad benzoic acid |manufacturer intermediates |pat impex india |anti scaling agent |zinc chemicals |plant growth regulator |mineral oils |water emulsion |Vadodara Gujarat India |fluoride chemicals |Dimethylaminoethanol |Dimethyl carbonate |mumbai bhiwandi maharashtra |DI-N-PROPYLAMINE |zeolites |EDTA 4NA Liquid |Tetrasodium EDTA |vadodara vapi ahmedabad surat |fumaric acid |GAMMA-BUTYROLACTONE |Malasiya importer |food glycine |pharma glycine |cosmetic glycine |importer in india |pat impex glycine |Glyoxylic acid 50% |Hexylene glycol |Hydrazine Hydrate 80% |Isobutyric acid |textile auxiliaries |textile chemicals |dechlorination chemicals |Ursodeoxycholic Acid |udca manufacturer |Glycerine pitch |Glycerine pitch manufacturer |Glycerine pitch suppliers |Glycerine pitch india |Hydroquinone |suppliers importers |Isobutanol |Malononitrile |MELAMINE CYANURATE |electrical chemicals |Methylcyclohexane |isobutene |coal chemicals |Monoethanolamines |aluminium sulphate |nickel chemicals |zinc electroplating |concrete repair |glycol |textile coatings |dealer distributor |uv coatings |curable coatings

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us