OMINDUSTRIALSERVICES Manufacturer
Vadodara +917779008081 patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products industry

Our Manufacturer

industry
1-Methoxy-2-propanol (also known as Propylene glycol methyl ether or PGME) is a versatile organic solvent used extensively in industrial, commercial, and manufacturing applications.
1-Methoxy-2-Propanol
VIEW DETAILS
1-Ethoxy-2-propanol (propylene glycol ethyl ether) is a versatile, low-toxicity organic solvent used primarily in industrial and commercial surface coatings, printing inks, and cleaning formulations.
1-Ethoxy-2-Propanol
VIEW DETAILS
Tween 80 (also known as Polysorbate 80) is a nonionic surfactant and emulsifier used to help mix ingredients like oil and water that normally separate.
Tween 80 Polysorbate 80
VIEW DETAILS
N-Methyl-2-pyrrolidone (NMP) is a powerful, polar aprotic solvent widely used across industrial, electronic, and pharmaceutical manufacturing due to its high boiling point and strong solvency.
N-Methyl-2-pyrrolidone (NMP)
VIEW DETAILS
Curcumin 95% is a concentrated botanical extract from turmeric root that contains 95% active curcuminoids used primarily as an antioxidant and anti-inflammatory dietary supplement.
Curcumin 95%
VIEW DETAILS
Tetrahydrofuran (THF) is a versatile, colorless liquid solvent primarily used as a precursor to polymers, pvc resin raw materials, coatings and inks raw materials, laboratory.
Tetrahydrofuran (THF)

INR 110

VIEW DETAILS
BASF Make Kollicoat Polymers for coating industry in India.Kollicoat Smartseal 100 P Highly effective taste masking, providing efficacy at low coating levels. Specifically suitable for pellets and particles for ODTs due to its easy processability. Methyl-methacrylate-diethylaminoethyl methacrylate co-polymerKollicoat Smartseal 30 D Highly effective taste masking at very low coating levels. Specifically suitable for pellets and particles for ODTs due to easy processability. Methyl-methacrylate – diethylaminoethyl methacrylate co-polymerKollicoat SR 30 D pH-independent sustained release film coating polymer with high plasticity used to coat small particles, pellets, granules and tablets. Ph.Eur.: Poly(vinyl acetate) dispersion 30 percent;USP/NF: Polyvinyl acetate dispersion
BASF Make Kollicoat Polymers
VIEW DETAILS
Kollicoat Protect used in Instant release coating polymer for the formulation of oxygen and moisture protective coatings.
Kollicoat Protect
VIEW DETAILS
Paints, Coatings & AdhesivesStabilizing Agent: 4-Hydroxyacetophenone acts as a stabilizing agent in paints and coatings, ensuring durability and resistance to UV degradation.Antimicrobial Additive: Its antimicrobial properties can be leveraged to enhance the resistance of coatings to microbial growth.Pulp & Paper SolutionsAntioxidant: It is employed as an antioxidant additive in the paper industry to improve the longevity and quality of paper products, protecting them from degradation due to exposure to air and light.Stabilizing Agent: 4-Hydroxyacetophenone can also be used in the production of specialty papers where chemical stability is crucial, particularly in environments where the paper might be exposed to heat or chemicals.Personal CareFragrance Ingredient: In the cosmetics industry, 4-Hydroxyacetophenone is used as a fragrance component, imparting a mild, sweet scent to perfumes, lotions, and creams.Antioxidant: Its antioxidant properties make it useful in anti-aging skincare products, helping to protect the skin from environmental damage and reducing the signs of aging.pH Regulator: It is sometimes used to balance the pH levels of formulations to ensure product stability and enhance the effectiveness of other active ingredients.Performance ChemicalsPolymerization Initiator: In chemical manufacturing, 4-Hydroxyacetophenone can act as an initiator for certain polymerization reactions, aiding in producing polymers with desired properties.Intermediate for Fine Chemicals: It is used as an intermediate in synthesizing fine chemicals, including dyes, agrochemicals, and specialty chemicals.Analytical Chemistry: In research and analytical labs, 4-Hydroxyacetophenone is utilized as a reagent or standard in various chemical assays and analyses.Food & Healthcare IngredientsFlavor Enhancer: 4-Hydroxyacetophenone is used as a flavoring agent due to its sweet, floral fragrance that enhances the aroma and taste profile of foods and beverages, such as candies and baked goods.Preservative: It has antioxidant properties that help preserve food products by preventing oxidation, thereby extending shelf life.
4-Hydroxyacetophenone
VIEW DETAILS
Propionic Acid pure Low PCF_EU is used as a versatile preservative in food or feed industry. For bakery products it preserves as a proprionate.Supplier of Propionic Acid Pure BASFHigh quality Propionic Acid Pure BASF, stock available Propionic Acid Pure BASFAvailable in customized packing and reliable prices of Propionic Acid Pure BASF
Propionic Acid Pure
VIEW DETAILS
Urethane Acrylate 70D (UA-70D) is a specialized UV-curable oligomer formulated to provide a hard, rigid finish with a Shore D hardness of ~70. It is widely used in high-performance UV-curable coatings, industrial adhesives, 3D printing resins, printing inks, and optical bonding film.
Urethane Acrylate 70D (UA-70D)
VIEW DETAILS
Vinyl Trimethoxysilane (VTMO) is a bifunctional organosilane used primarily as a crosslinking agent, adhesion promoter, and moisture scavenger in sealants, coatings, and plastics.
Vinyl Trimethoxysilane (VTMO)
VIEW DETAILS
Ludiflash, developed by BASF, is a ready-to-use co-processed excipient specifically used in the pharmaceutical and nutraceutical industries to manufacture orodispersible tablets (ODTs), also known as fast-dissolving or melt-in-the-mouth tablets
Ludiflash
VIEW DETAILS
Kollidon CL (chemically known as crospovidone) is a water-insoluble, crosslinked polyvinylpyrrolidone (PVP) primarily used in the pharmaceutical and nutraceutical industries as a superdisintegrant and dissolution enhancer for tablets, capsules, and granules. Stock Availlabe Kollidon CL in Vadodara, Gujarat INDIA.
Kollidon CL
VIEW DETAILS
Kollidon 30 LP stock available in India,low peroxide grade of Povidone K30 containing an antioxidant. Importer of Kollidon 30 LP in Vadodara Gujarat India.
Kollidon 30 LP
VIEW DETAILS
K-LAC 6040 Alpha monohydrate lactose powder K-LAC 6040 is a pharmaceutical-grade, ready-to-use excipient blend composed of 60% Lactose Monohydrate and 40% Maize Starch. It is primarily used in the pharmaceutical and nutraceutical industries as a direct compression vehicle, binder, and filler for manufacturing solid oral dosage forms like tablets and capsules.
K-LAC 6040 Alpha monohydrate lactose p
VIEW DETAILS
Jindal Euro 707 Cocoa Powder , 250g, delivers a premium chocolate flavor ideal for baking, cooking, and beverages. Known for its smooth texture and rich color, this cocoa powder enhances desserts and drinks. Elevate your culinary creations with the superior taste and quality of Jindal Cocoa Powder Euro 707
Jindal Euro 707 Cocoa Powder

INR 760

VIEW DETAILS
Jindal Cocoa Powder 101, 250g, provides a classic chocolate flavor essential for baking and beverages. With a fine texture and deep cocoa richness, it elevates cakes, cookies, hot chocolates, and savory dishes. A reliable choice for achieving delightful chocolatey creations at home or in professional settings.
Jindal Cocoa Powder 101
VIEW DETAILS
Red Pouch Dutched Cocoa Powder, 950g, offers a rich, smooth, and intense chocolate flavor, perfect for baking, cooking, and beverages. This premium, alkalized cocoa powder ensures a velvety texture and deep color, enhancing your culinary creations. Ideal for elevating your desserts and drinks with exceptional quality and taste. Red Pouch Dutched Cocoa Powder supplier in Vadodara Mumbai South india, Gujarat India.
Red Pouch Dutched Cocoa Powder

INR 750

VIEW DETAILS
Jindal 301 Cocoa Powder ,250g, delivers a smooth and rich chocolate flavor, perfect for baking and beverages. Known for its fine texture and deep cocoa notes, it enhances desserts, hot chocolate, and savory recipes. Ideal for creating indulgent treats with consistent quality and superior taste. supplier of Jindal 301 Cocoa Powder in Vadodara Mumbai Karnataka Kerela Gujarat Rajasthan India.
Jindal 301 Cocoa Powder
VIEW DETAILS
Jindal 401 Cocoa Powder,250g, provides a balanced chocolate flavor perfect for baking and cooking. Its fine texture and deep color enhance desserts, beverages like hot chocolate, and savory dishes. Ideal for both professional chefs and home cooks seeking quality cocoa powder for diverse culinary creations.
Jindal 401 Cocoa Powder

INR 600

VIEW DETAILS
Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations
Jindal Euro 900 Cocoa Powder
VIEW DETAILS
L-citrulline is a naturally occurring amino acid that the body converts into L-arginine, boosting nitric oxide production and improving blood flow. Stock available L - Citrulline in Vadodara Gujarat India
L - Citrulline

INR 800

VIEW DETAILS
Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations. Elevate your desserts and drinks with the superior quality of Jindal Cocoa Powder Euro 900
Jindal Euro 900 Cocoa Powder

INR 839

VIEW DETAILS
Hydrocarbon PolyterpeneAdhesives & Sealants: These are the primary applications, where polyterpenes are used as tackifiers in:Pressure-Sensitive Adhesives (PSAs): High-performance adhesives for tapes, labels, and specialty films.Hot-Melt Adhesives (HMAs): Used in packaging, carton closing, bookbinding, diapers, and sanitary products.Solvent-Based Adhesives: Used in rubber cements and friction tapes.Sealants & Mastics: Including tire puncture sealants.Rubber & Tire Industry: Polyterpenes act as tackifying agents in rubber compounding (natural rubber, SBR, neoprene, EVA), increasing bond strength and heat resistance.Paints, Coatings, and Inks: They improve adhesion, flexibility, and gloss, particularly in printing inks and specialty coatings.Food & Medical Applications: Due to their non-toxic nature, they are used in:Chewing Gum Base: Providing masticatory elasticity.Food Packaging: In films intended for indirect food contact.Medical Rubber Goods: Including medical-grade adhesive tapes.Paper Sizing: Used in the paper industry to improve moisture barrier properties and resistance to wetting.
Hydrocarbon Polyterpene
VIEW DETAILS
1,4-Dioxane is a synthetic industrial solvent used primarily in manufacturing paints, varnishes, adhesives, and electronics, as well as a stabilizer for chlorinated solvents. It is commonly found as a byproduct in consumer products like personal care items (shampoos, gels) and detergents, or as an environmental contaminant.
1,4-Dioxane
VIEW DETAILS
Pregelatinized starch stock available, Pregelatinized starch used in Pharmaceuticals Excipient, food industry, Adhesives binders and construction uses. Call for price.
Pregelatinized starch
VIEW DETAILS
Vitamin A Palmitate 1.7 miu best for food industry, personal care products manufacturing and cosmetic industry. Best for pharma formulation and other pharma additives.
Vitamin A Palmitate 1.7 miu
VIEW DETAILS
Tetrahydrofurfuryl methacrylate (THFMA) is a versatile biobased monomer used to produce high-performance polymers, coatings, adhesives, and sealants, often favored for enhancing flexibility and strength.
Tetrahydrofurfuryl methacrylate (THFMA
VIEW DETAILS
4-Hydroxybutyl acrylate (4-HBA) is a monofunctional monomer primarily used to produce high-performance acrylic resins, UV/EB-curable inks, coatings, and adhesives
4-Hydroxybutyl acrylate
VIEW DETAILS
Methoxy propanol acetate (PMA or PGMEA) is a versatile, low-toxicity, and biodegradable industrial solvent with a mild odor, primarily used as a solvent for paints, inks, and resins
Methoxy propanol acetate
VIEW DETAILS
1,6-Hexanediol Diacrylate (HDDA) is a difunctional monomer widely used as a reactive diluent and crosslinking agent in UV/EB-curable coatings, inks, and adhesives. It offers low viscosity, fast curing, and enhances chemical/abrasion resistance, hardness, and flexibility in products. Key uses include 3D printing, electronics, textiles, and optical fibers.
1,6-Hexanediol Diacrylate (HDDA)
VIEW DETAILS
Methoxy propanol (Propylene Glycol Methyl Ether/PGM) is a versatile, low-toxicity, low-viscosity solvent utilized primarily in paints, inks, cleaning products, and electronics
Methoxy propanol
VIEW DETAILS
2-Methoxyethyl acrylate (MTA) is a specialty monomer used to produce polymers, coatings, adhesives, and paints.
2-Methoxyethyl acrylate
VIEW DETAILS
Isobutyl methacrylate (IBMA) is a versatile functional monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants.
Isobutyl methacrylate (IBMA)
VIEW DETAILS
Neopentyl glycol (NPG) is a crucial intermediate used primarily in the production of high-performance saturated polyester resins, powder coatings, and alkyd resins, enhancing durability, weathering, and corrosion resistance. Its key uses include automotive coatings, industrial lubricants, synthetic ester lubricants, plasticizers, and unsaturated polyesters (UPR) for composite materials
Neopentyl glycol (NPG)
VIEW DETAILS
Monopropylene glycol (MPG) is a versatile, low-toxicity chemical used primarily as an industrial antifreeze/coolant, a solvent for pharmaceuticals and cosmetics, and a stabilizer in food products.
Monopropylene glycol (MPG)
VIEW DETAILS
Ethyl glycol acetate (EGA) is a high-performance solvent used primarily in surface coatings, printing inks, and paints due to its slow evaporation rate and excellent dissolving power for resins like acrylic, nitrocellulose, and epoxy. It serves as a coalescing agent for coatings and as a solvent for industrial cleaning.
Ethyl glycol acetate (2-ethoxyethyl ac
VIEW DETAILS
3-Ethyl-3-oxetanemethanol (CAS 3047-32-3) is a versatile UV-curable monomer and reactive diluent used primarily in UV-curable inks, coatings, and adhesives. It acts as a specialized chemical intermediate for producing hyperbranched polyethers, pharmaceuticals, and advanced materials requiring improved flexibility, chemical resistance, and cationic polymerization properties.
3 ethyl 3 oxetanemethanol
VIEW DETAILS
N-butanol (1-butanol) is a versatile, four-carbon industrial alcohol primarily used as a solvent in paints, coatings, varnishes, and resins, and as a chemical intermediate to produce butyl acrylate, butyl acetate, and plasticizers. It is also used in pharmaceuticals (extractant), personal care products, hydraulic fluids, and as a potential biofuel
N Butanol
VIEW DETAILS
Jeffamine D-230 is a low-viscosity, polyether diamine primarily used as a high-performance curing agent for epoxy resins to produce tough, clear, and impact-resistant coatings, adhesives, and composites. It is widely used in polyurea systems, polyurethane chain extension, and in industrial coatings, fillers, and amine neutralizers for paints.
Jeffamine D-230

INR 100

VIEW DETAILS
Polyethylene Glycol (200) Diacrylate (PEG200DA) is a low-viscosity, fast-curing, bifunctional monomer used primarily as a reactive diluent, crosslinking agent, and binder in UV-curable coatings, inks, adhesives, and electronics.
POLYETHYLENE GLYCOL(200) DIACRYLATE (P
VIEW DETAILS
Benfotiamine IH is primarily used in dietary supplements for its ability to support and maintain healthy nerve function. Its high level of purity and solubility in water facilitates its use in various supplement formulations intended for adult wellness.
Benfotiamine IH
VIEW DETAILS
Sodium cyclamate is a non-nutritive, high-intensity, heat-stable artificial sweetener used primarily in low-calorie foods, beverages, tabletop sweeteners, pharmaceuticals, and cosmetics, being 30-50 times sweeter than sugar. It is commonly used in combination with other sweeteners like saccharin to mask aftertastesFood and Beverage Industry: Used in diet sodas, canned fruits, jams, jellies, desserts, yogurt, and candies. It is particularly favored for its stability under heat, making it suitable for baking and cooking.Tabletop Sweeteners: Used in powder, tablet, or liquid forms for coffee, tea, and home use.Pharmaceuticals: Applied in medicines, such as oral liquids, syrups, and lozenges, to mask bitter tastes and improve patient compliance.Personal Care Products: Included in toothpaste, mouthwash, and lip gloss for a sweet taste without causing tooth decay.Industrial/Other Uses: Used in certain specialty products, such as fragrant coatings.
Sodium cyclamate
VIEW DETAILS
L-phenylalanine is an essential amino acid that the human body cannot produce on its own and must be obtained through diet or supplements. It is primarily found in protein-rich foods like meat, fish, eggs, and dairy. Stock Available L-phenylalanine in Vadodara Gujarat India.
L-phenylalanine
VIEW DETAILS
L-carnitine L–tartrate powderIt helps the body turn fat into energy. L-carnitine is important for heart and brain function, muscle.
L-carnitine L–tartrate powder
VIEW DETAILS
Key applications of TDI 80/20 include:Flexible Polyurethane Foam: The primary use is in manufacturing soft foams for upholstery, mattresses, pillows, and automotive seating.Coatings and Varnishes: Used in producing durable, high-performance coatings, particularly for wood, metal, and automotive applications.Adhesives and Sealants: Employed to create strong bonding materials for construction and industrial use.Elastomers: Used to produce specialized, durable elastomers like wheels, gaskets, and seals.Specialty Applications: Applied in packaging materials, technical insulating foams, and specialized items like toy molding
Toluene Diisocyanate (TDI 80/20)

INR 220

VIEW DETAILS
N-Butyl Methacrylate (nBMA) is a versatile, hydrophobic monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants, offering flexibility, durability, and UV/water resistance. It serves as a plasticizing co-monomer in automotive coatings, industrial paints, textile/leather finishing, dental materials, and oil additives
N BUTYL METHACRYLATE
VIEW DETAILS
MONO ISOPROPANOL AMINE uses in intermediate, neutralizer, emulsifier, and stabilizer in industries like personal care, agrochemicals, coatings, and metalworking. It is primarily used for pH adjustment, anticorrosion, fatty acid neutralization, and synthesizing surfactants, pharmaceuticals, and polyurethane
MONO ISOPROPANOL AMINE

INR 250

VIEW DETAILS
Methylcyclohexane (MCH) is a versatile solvent and chemical intermediate used extensively in industrial processes, such as for paints, coatings, adhesives, and cleaning agents due to its ability to dissolve hydrophobic materials. It acts as a jet fuel component/surrogate and in refining to produce toluene
Methylcyclohexane MCH

INR 165

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediatefood supplementsbakery chemicalstofu processing chemicalsbone filler chemicalsdental chemicalsorthopedic chemicalsice control chemicalsdust control chemicalsepsom saltssports drinks chemicalsde icing chemicalsindian manufacturerbaddi himachal pradeshPharma Api Powderapi suppliershyderabad benzoic acidmanufacturer intermediatespat impex indiaanti scaling agentzinc chemicalsplant growth regulatormineral oilswater emulsionVadodara Gujarat Indiafluoride chemicalsDimethylaminoethanolDimethyl carbonatemumbai bhiwandi maharashtraDI-N-PROPYLAMINEzeolitesEDTA 4NA LiquidTetrasodium EDTAvadodara vapi ahmedabad suratfumaric acidGAMMA-BUTYROLACTONEMalasiya importerfood glycinepharma glycinecosmetic glycineimporter in indiapat impex glycineGlyoxylic acid 50%Hexylene glycolHydrazine Hydrate 80%Isobutyric acidtextile auxiliariestextile chemicalsdechlorination chemicalsUrsodeoxycholic Acidudca manufacturerGlycerine pitchGlycerine pitch manufacturerGlycerine pitch suppliersGlycerine pitch indiaHydroquinonesuppliers importersIsobutanolMalononitrileMELAMINE CYANURATEelectrical chemicalsMethylcyclohexaneisobutenecoal chemicalsMonoethanolaminesaluminium sulphatenickel chemicalszinc electroplatingconcrete repairglycoltextile coatingsdealer distributoruv coatingscurable coatingsresin raw materialculture mediaculture media baseorganometallic reducing agentchematek synhydrideTert-butyldimethylsilyl chlorideTitanocene dichloridecocoa powdersulphate chemicalsfoam boostermaize starchcapsules chemicalsdisintegrant chemicalscolor removal chemicalsdrying agent chemicalsdehydrating chemicalsink chemicalsuv adhesiveslithium chemicalsperformance chemicalshousehold chemicalsglucosidesgrease removal additive
1-Methoxy-2-propanol (also known as Propylene glycol methyl ether or PGME) is a versatile organic solvent used extensively in industrial, commercial, and manufacturing applications.
View Details
1-Methoxy-2-Propanol
1-Ethoxy-2-propanol (propylene glycol ethyl ether) is a versatile, low-toxicity organic solvent used primarily in industrial and commercial surface coatings, printing inks, and cleaning formulations.
View Details
1-Ethoxy-2-Propanol
Tween 80 (also known as Polysorbate 80) is a nonionic surfactant and emulsifier used to help mix ingredients like oil and water that normally separate.
View Details
Tween 80 Polysorbate 80
N-Methyl-2-pyrrolidone (NMP) is a powerful, polar aprotic solvent widely used across industrial, electronic, and pharmaceutical manufacturing due to its high boiling point and strong solvency.
View Details
N-Methyl-2-pyrrolidone (
Curcumin 95% is a concentrated botanical extract from turmeric root that contains 95% active curcuminoids used primarily as an antioxidant and anti-inflammatory dietary supplement.
View Details
Curcumin 95%
Tetrahydrofuran (THF) is a versatile, colorless liquid solvent primarily used as a precursor to polymers, pvc resin raw materials, coatings and inks raw materials, laboratory.
View Details
Tetrahydrofuran (THF)

INR 110

BASF Make Kollicoat Polymers for coating industry in India.Kollicoat Smartseal 100 P Highly effective taste masking, providing efficacy at low coating levels. Specifically suitable for pellets and particles for ODTs due to its easy processability. Methyl-methacrylate-diethylaminoethyl methacrylate co-polymerKollicoat Smartseal 30 D Highly effective taste masking at very low coating levels. Specifically suitable for pellets and particles for ODTs due to easy processability. Methyl-methacrylate – diethylaminoethyl methacrylate co-polymerKollicoat SR 30 D pH-independent sustained release film coating polymer with high plasticity used to coat small particles, pellets, granules and tablets. Ph.Eur.: Poly(vinyl acetate) dispersion 30 percent;USP/NF: Polyvinyl acetate dispersion
View Details
BASF Make Kollicoat Poly
Kollicoat Protect used in Instant release coating polymer for the formulation of oxygen and moisture protective coatings.
View Details
Kollicoat Protect
Paints, Coatings & AdhesivesStabilizing Agent: 4-Hydroxyacetophenone acts as a stabilizing agent in paints and coatings, ensuring durability and resistance to UV degradation.Antimicrobial Additive: Its antimicrobial properties can be leveraged to enhance the resistance of coatings to microbial growth.Pulp & Paper SolutionsAntioxidant: It is employed as an antioxidant additive in the paper industry to improve the longevity and quality of paper products, protecting them from degradation due to exposure to air and light.Stabilizing Agent: 4-Hydroxyacetophenone can also be used in the production of specialty papers where chemical stability is crucial, particularly in environments where the paper might be exposed to heat or chemicals.Personal CareFragrance Ingredient: In the cosmetics industry, 4-Hydroxyacetophenone is used as a fragrance component, imparting a mild, sweet scent to perfumes, lotions, and creams.Antioxidant: Its antioxidant properties make it useful in anti-aging skincare products, helping to protect the skin from environmental damage and reducing the signs of aging.pH Regulator: It is sometimes used to balance the pH levels of formulations to ensure product stability and enhance the effectiveness of other active ingredients.Performance ChemicalsPolymerization Initiator: In chemical manufacturing, 4-Hydroxyacetophenone can act as an initiator for certain polymerization reactions, aiding in producing polymers with desired properties.Intermediate for Fine Chemicals: It is used as an intermediate in synthesizing fine chemicals, including dyes, agrochemicals, and specialty chemicals.Analytical Chemistry: In research and analytical labs, 4-Hydroxyacetophenone is utilized as a reagent or standard in various chemical assays and analyses.Food & Healthcare IngredientsFlavor Enhancer: 4-Hydroxyacetophenone is used as a flavoring agent due to its sweet, floral fragrance that enhances the aroma and taste profile of foods and beverages, such as candies and baked goods.Preservative: It has antioxidant properties that help preserve food products by preventing oxidation, thereby extending shelf life.
View Details
4-Hydroxyacetophenone
Propionic Acid pure Low PCF_EU is used as a versatile preservative in food or feed industry. For bakery products it preserves as a proprionate.Supplier of Propionic Acid Pure BASFHigh quality Propionic Acid Pure BASF, stock available Propionic Acid Pure BASFAvailable in customized packing and reliable prices of Propionic Acid Pure BASF
View Details
Propionic Acid Pure
Urethane Acrylate 70D (UA-70D) is a specialized UV-curable oligomer formulated to provide a hard, rigid finish with a Shore D hardness of ~70. It is widely used in high-performance UV-curable coatings, industrial adhesives, 3D printing resins, printing inks, and optical bonding film.
View Details
Urethane Acrylate 70D (U
Vinyl Trimethoxysilane (VTMO) is a bifunctional organosilane used primarily as a crosslinking agent, adhesion promoter, and moisture scavenger in sealants, coatings, and plastics.
View Details
Vinyl Trimethoxysilane (
Ludiflash, developed by BASF, is a ready-to-use co-processed excipient specifically used in the pharmaceutical and nutraceutical industries to manufacture orodispersible tablets (ODTs), also known as fast-dissolving or melt-in-the-mouth tablets
View Details
Ludiflash
Kollidon CL (chemically known as crospovidone) is a water-insoluble, crosslinked polyvinylpyrrolidone (PVP) primarily used in the pharmaceutical and nutraceutical industries as a superdisintegrant and dissolution enhancer for tablets, capsules, and granules. Stock Availlabe Kollidon CL in Vadodara, Gujarat INDIA.
View Details
Kollidon CL
Kollidon 30 LP stock available in India,low peroxide grade of Povidone K30 containing an antioxidant. Importer of Kollidon 30 LP in Vadodara Gujarat India.
View Details
Kollidon 30 LP
K-LAC 6040 Alpha monohydrate lactose powder K-LAC 6040 is a pharmaceutical-grade, ready-to-use excipient blend composed of 60% Lactose Monohydrate and 40% Maize Starch. It is primarily used in the pharmaceutical and nutraceutical industries as a direct compression vehicle, binder, and filler for manufacturing solid oral dosage forms like tablets and capsules.
View Details
K-LAC 6040 Alpha monohyd
Jindal Euro 707 Cocoa Powder , 250g, delivers a premium chocolate flavor ideal for baking, cooking, and beverages. Known for its smooth texture and rich color, this cocoa powder enhances desserts and drinks. Elevate your culinary creations with the superior taste and quality of Jindal Cocoa Powder Euro 707
View Details
Jindal Euro 707 Cocoa Po

INR 760

Jindal Cocoa Powder 101, 250g, provides a classic chocolate flavor essential for baking and beverages. With a fine texture and deep cocoa richness, it elevates cakes, cookies, hot chocolates, and savory dishes. A reliable choice for achieving delightful chocolatey creations at home or in professional settings.
View Details
Jindal Cocoa Powder 101
Red Pouch Dutched Cocoa Powder, 950g, offers a rich, smooth, and intense chocolate flavor, perfect for baking, cooking, and beverages. This premium, alkalized cocoa powder ensures a velvety texture and deep color, enhancing your culinary creations. Ideal for elevating your desserts and drinks with exceptional quality and taste. Red Pouch Dutched Cocoa Powder supplier in Vadodara Mumbai South india, Gujarat India.
View Details
Red Pouch Dutched Cocoa

INR 750

Jindal 301 Cocoa Powder ,250g, delivers a smooth and rich chocolate flavor, perfect for baking and beverages. Known for its fine texture and deep cocoa notes, it enhances desserts, hot chocolate, and savory recipes. Ideal for creating indulgent treats with consistent quality and superior taste. supplier of Jindal 301 Cocoa Powder in Vadodara Mumbai Karnataka Kerela Gujarat Rajasthan India.
View Details
Jindal 301 Cocoa Powder
Jindal 401 Cocoa Powder,250g, provides a balanced chocolate flavor perfect for baking and cooking. Its fine texture and deep color enhance desserts, beverages like hot chocolate, and savory dishes. Ideal for both professional chefs and home cooks seeking quality cocoa powder for diverse culinary creations.
View Details
Jindal 401 Cocoa Powder

INR 600

Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations
View Details
Jindal Euro 900 Cocoa Po
L-citrulline is a naturally occurring amino acid that the body converts into L-arginine, boosting nitric oxide production and improving blood flow. Stock available L - Citrulline in Vadodara Gujarat India
View Details
L - Citrulline

INR 800

Jindal Euro 900 Cocoa Powder, 250g, delivers a robust and rich chocolate flavor, ideal for baking, cooking, and beverages. This premium cocoa powder ensures a smooth texture and deep color, enhancing your culinary creations. Elevate your desserts and drinks with the superior quality of Jindal Cocoa Powder Euro 900
View Details
Jindal Euro 900 Cocoa Po

INR 839

Hydrocarbon PolyterpeneAdhesives & Sealants: These are the primary applications, where polyterpenes are used as tackifiers in:Pressure-Sensitive Adhesives (PSAs): High-performance adhesives for tapes, labels, and specialty films.Hot-Melt Adhesives (HMAs): Used in packaging, carton closing, bookbinding, diapers, and sanitary products.Solvent-Based Adhesives: Used in rubber cements and friction tapes.Sealants & Mastics: Including tire puncture sealants.Rubber & Tire Industry: Polyterpenes act as tackifying agents in rubber compounding (natural rubber, SBR, neoprene, EVA), increasing bond strength and heat resistance.Paints, Coatings, and Inks: They improve adhesion, flexibility, and gloss, particularly in printing inks and specialty coatings.Food & Medical Applications: Due to their non-toxic nature, they are used in:Chewing Gum Base: Providing masticatory elasticity.Food Packaging: In films intended for indirect food contact.Medical Rubber Goods: Including medical-grade adhesive tapes.Paper Sizing: Used in the paper industry to improve moisture barrier properties and resistance to wetting.
View Details
Hydrocarbon Polyterpene
1,4-Dioxane is a synthetic industrial solvent used primarily in manufacturing paints, varnishes, adhesives, and electronics, as well as a stabilizer for chlorinated solvents. It is commonly found as a byproduct in consumer products like personal care items (shampoos, gels) and detergents, or as an environmental contaminant.
View Details
1,4-Dioxane
Pregelatinized starch stock available, Pregelatinized starch used in Pharmaceuticals Excipient, food industry, Adhesives binders and construction uses. Call for price.
View Details
Pregelatinized starch
Vitamin A Palmitate 1.7 miu best for food industry, personal care products manufacturing and cosmetic industry. Best for pharma formulation and other pharma additives.
View Details
Vitamin A Palmitate 1.7
Tetrahydrofurfuryl methacrylate (THFMA) is a versatile biobased monomer used to produce high-performance polymers, coatings, adhesives, and sealants, often favored for enhancing flexibility and strength.
View Details
Tetrahydrofurfuryl metha
4-Hydroxybutyl acrylate (4-HBA) is a monofunctional monomer primarily used to produce high-performance acrylic resins, UV/EB-curable inks, coatings, and adhesives
View Details
4-Hydroxybutyl acrylate
Methoxy propanol acetate (PMA or PGMEA) is a versatile, low-toxicity, and biodegradable industrial solvent with a mild odor, primarily used as a solvent for paints, inks, and resins
View Details
Methoxy propanol acetate
1,6-Hexanediol Diacrylate (HDDA) is a difunctional monomer widely used as a reactive diluent and crosslinking agent in UV/EB-curable coatings, inks, and adhesives. It offers low viscosity, fast curing, and enhances chemical/abrasion resistance, hardness, and flexibility in products. Key uses include 3D printing, electronics, textiles, and optical fibers.
View Details
1,6-Hexanediol Diacrylat
Methoxy propanol (Propylene Glycol Methyl Ether/PGM) is a versatile, low-toxicity, low-viscosity solvent utilized primarily in paints, inks, cleaning products, and electronics
View Details
Methoxy propanol
2-Methoxyethyl acrylate (MTA) is a specialty monomer used to produce polymers, coatings, adhesives, and paints.
View Details
2-Methoxyethyl acrylate
Isobutyl methacrylate (IBMA) is a versatile functional monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants.
View Details
Isobutyl methacrylate (I
Neopentyl glycol (NPG) is a crucial intermediate used primarily in the production of high-performance saturated polyester resins, powder coatings, and alkyd resins, enhancing durability, weathering, and corrosion resistance. Its key uses include automotive coatings, industrial lubricants, synthetic ester lubricants, plasticizers, and unsaturated polyesters (UPR) for composite materials
View Details
Neopentyl glycol (NPG)
Monopropylene glycol (MPG) is a versatile, low-toxicity chemical used primarily as an industrial antifreeze/coolant, a solvent for pharmaceuticals and cosmetics, and a stabilizer in food products.
View Details
Monopropylene glycol (MP
Ethyl glycol acetate (EGA) is a high-performance solvent used primarily in surface coatings, printing inks, and paints due to its slow evaporation rate and excellent dissolving power for resins like acrylic, nitrocellulose, and epoxy. It serves as a coalescing agent for coatings and as a solvent for industrial cleaning.
View Details
Ethyl glycol acetate (2
3-Ethyl-3-oxetanemethanol (CAS 3047-32-3) is a versatile UV-curable monomer and reactive diluent used primarily in UV-curable inks, coatings, and adhesives. It acts as a specialized chemical intermediate for producing hyperbranched polyethers, pharmaceuticals, and advanced materials requiring improved flexibility, chemical resistance, and cationic polymerization properties.
View Details
3 ethyl 3 oxetanemethano
N-butanol (1-butanol) is a versatile, four-carbon industrial alcohol primarily used as a solvent in paints, coatings, varnishes, and resins, and as a chemical intermediate to produce butyl acrylate, butyl acetate, and plasticizers. It is also used in pharmaceuticals (extractant), personal care products, hydraulic fluids, and as a potential biofuel
View Details
N Butanol
Jeffamine D-230 is a low-viscosity, polyether diamine primarily used as a high-performance curing agent for epoxy resins to produce tough, clear, and impact-resistant coatings, adhesives, and composites. It is widely used in polyurea systems, polyurethane chain extension, and in industrial coatings, fillers, and amine neutralizers for paints.
View Details
Jeffamine D-230

INR 100

Polyethylene Glycol (200) Diacrylate (PEG200DA) is a low-viscosity, fast-curing, bifunctional monomer used primarily as a reactive diluent, crosslinking agent, and binder in UV-curable coatings, inks, adhesives, and electronics.
View Details
POLYETHYLENE GLYCOL(200)
Benfotiamine IH is primarily used in dietary supplements for its ability to support and maintain healthy nerve function. Its high level of purity and solubility in water facilitates its use in various supplement formulations intended for adult wellness.
View Details
Benfotiamine IH
Sodium cyclamate is a non-nutritive, high-intensity, heat-stable artificial sweetener used primarily in low-calorie foods, beverages, tabletop sweeteners, pharmaceuticals, and cosmetics, being 30-50 times sweeter than sugar. It is commonly used in combination with other sweeteners like saccharin to mask aftertastesFood and Beverage Industry: Used in diet sodas, canned fruits, jams, jellies, desserts, yogurt, and candies. It is particularly favored for its stability under heat, making it suitable for baking and cooking.Tabletop Sweeteners: Used in powder, tablet, or liquid forms for coffee, tea, and home use.Pharmaceuticals: Applied in medicines, such as oral liquids, syrups, and lozenges, to mask bitter tastes and improve patient compliance.Personal Care Products: Included in toothpaste, mouthwash, and lip gloss for a sweet taste without causing tooth decay.Industrial/Other Uses: Used in certain specialty products, such as fragrant coatings.
View Details
Sodium cyclamate
L-phenylalanine is an essential amino acid that the human body cannot produce on its own and must be obtained through diet or supplements. It is primarily found in protein-rich foods like meat, fish, eggs, and dairy. Stock Available L-phenylalanine in Vadodara Gujarat India.
View Details
L-phenylalanine
L-carnitine L–tartrate powderIt helps the body turn fat into energy. L-carnitine is important for heart and brain function, muscle.
View Details
L-carnitine L–tartrate p
Key applications of TDI 80/20 include:Flexible Polyurethane Foam: The primary use is in manufacturing soft foams for upholstery, mattresses, pillows, and automotive seating.Coatings and Varnishes: Used in producing durable, high-performance coatings, particularly for wood, metal, and automotive applications.Adhesives and Sealants: Employed to create strong bonding materials for construction and industrial use.Elastomers: Used to produce specialized, durable elastomers like wheels, gaskets, and seals.Specialty Applications: Applied in packaging materials, technical insulating foams, and specialized items like toy molding
View Details
Toluene Diisocyanate (TD

INR 220

N-Butyl Methacrylate (nBMA) is a versatile, hydrophobic monomer used primarily to produce acrylic resins, coatings, adhesives, and sealants, offering flexibility, durability, and UV/water resistance. It serves as a plasticizing co-monomer in automotive coatings, industrial paints, textile/leather finishing, dental materials, and oil additives
View Details
N BUTYL METHACRYLATE
MONO ISOPROPANOL AMINE uses in intermediate, neutralizer, emulsifier, and stabilizer in industries like personal care, agrochemicals, coatings, and metalworking. It is primarily used for pH adjustment, anticorrosion, fatty acid neutralization, and synthesizing surfactants, pharmaceuticals, and polyurethane
View Details
MONO ISOPROPANOL AMINE

INR 250

Methylcyclohexane (MCH) is a versatile solvent and chemical intermediate used extensively in industrial processes, such as for paints, coatings, adhesives, and cleaning agents due to its ability to dissolve hydrophobic materials. It acts as a jet fuel component/surrogate and in refining to produce toluene
View Details
Methylcyclohexane MCH

INR 165

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate |food supplements |bakery chemicals |tofu processing chemicals |bone filler chemicals |dental chemicals |orthopedic chemicals |ice control chemicals |dust control chemicals |epsom salts |sports drinks chemicals |de icing chemicals |indian manufacturer |baddi himachal pradesh |Pharma Api Powder |api suppliers |hyderabad benzoic acid |manufacturer intermediates |pat impex india |anti scaling agent |zinc chemicals |plant growth regulator |mineral oils |water emulsion |Vadodara Gujarat India |fluoride chemicals |Dimethylaminoethanol |Dimethyl carbonate |mumbai bhiwandi maharashtra |DI-N-PROPYLAMINE |zeolites |EDTA 4NA Liquid |Tetrasodium EDTA |vadodara vapi ahmedabad surat |fumaric acid |GAMMA-BUTYROLACTONE |Malasiya importer |food glycine |pharma glycine |cosmetic glycine |importer in india |pat impex glycine |Glyoxylic acid 50% |Hexylene glycol |Hydrazine Hydrate 80% |Isobutyric acid |textile auxiliaries |textile chemicals |dechlorination chemicals |Ursodeoxycholic Acid |udca manufacturer |Glycerine pitch |Glycerine pitch manufacturer |Glycerine pitch suppliers |Glycerine pitch india |Hydroquinone |suppliers importers |Isobutanol |Malononitrile |MELAMINE CYANURATE |electrical chemicals |Methylcyclohexane |isobutene |coal chemicals |Monoethanolamines |aluminium sulphate |nickel chemicals |zinc electroplating |concrete repair |glycol |textile coatings |dealer distributor |uv coatings |curable coatings |resin raw material |culture media |culture media base |organometallic reducing agent |chematek synhydride |Tert-butyldimethylsilyl chloride |Titanocene dichloride |cocoa powder |sulphate chemicals |foam booster |maize starch |capsules chemicals |disintegrant chemicals |color removal chemicals |drying agent chemicals |dehydrating chemicals |ink chemicals |uv adhesives |lithium chemicals |performance chemicals |household chemicals |glucosides |grease removal additive

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share