OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products vadodara

Our Manufacturer

vadodara
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
Lidocaine Base HCL IP BP USP
VIEW DETAILS
Emerged as a reputed Material & Service provider of the industry, we are engaged in rendering qualitative Various Floor Coating Material and Services.Epoxy FlooringPU FlooringUcrate FlooringMastic FlooringHeavy Screed Flooring3D FlooringMettalic FlooringDesigner FlooringMicro Chipping FlooringPolyUratha FlooringConductive / Anti Static FlooringHybrid Flooring
Floor and Wall Coating

INR 57 INR 58
You Save 1.72%

VIEW DETAILS
2-Chloro-5-Nitrobenzoic Acid raw materials, powder manufacturer of nitrobenzoic acid
2-Chloro-5-Nitrobenzoic Acid

INR 2480 INR 2500
You Save 0.8%

VIEW DETAILS
TUNGSTATE CHEMICALS MANUFACTURER, TUNGSTATE PIGMENTS, TUNGSTATE SODIUM CHEMICALS, Tungsten Carbide PowderTungsten PowderPotassium TungstateSodium Tungstate HydrateTungstic AcidPhosphotungstic Acid HydrateSodium MetatungstateTungsten TrioxideSilicotungstic AcidTungsten DisulphideAmmonium Para TungstateAmmonium Meta TungstateCadmium tungstateCobalt TungstateCesium TungstateMagnesium TungstateBismuth Tungsten OxideManganese TungstateBarium Tungstate
TUNGSTATE CHEMICALS MANUFACTURER

INR 335 INR 390
You Save 14.1%

VIEW DETAILS
SILVER SULFADIAZINE STOCK, silver pharma chemicals, sulfadiazine pharma raw materials, Stock Available
SILVER SULFADIAZINE
VIEW DETAILS
Ethyl chemicals, acetate chemicals, bromide chemicalsEthyl acetateEthyl BromideEthyl cellosolveEthyl CelluloseEthyl Chlorideethyl chloroacetateEthyl Cyano Acetate (ECA)Ethyl Cyano Acrylate
ETHYL CHEMICALS

INR 253 INR 255
You Save 0.78%

VIEW DETAILS
MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS pharma grade, bp MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS, usp MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS, ip MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS
MAGNESIUM SULPHATE MONOHYDRATE & ANHYD

INR 186 INR 188
You Save 1.06%

VIEW DETAILS
medicinal CHROMIUM PICOLINATE USP, pharma grade CHROMIUM PICOLINATE USP, high quality CHROMIUM PICOLINATE USP, Chromium picolinate has been used in alternative medicine to treat chromium deficiency, as an aid to controlling blood sugar in people with diabetes or prediabetes, to lower cholesterol, and as a weight-loss supplement.
CHROMIUM PICOLINATE USP

INR 2278 INR 2280
You Save 0.09%

VIEW DETAILS
pharma grade EDETATE DISODIUM DIHYDRATE IP BP USP, animal feed EDETATE DISODIUM DIHYDRATE IP BP, feed EDETATE DISODIUM DIHYDRATE USP, cosmetic EDETATE DISODIUM DIHYDRATE,
EDETATE DISODIUM DIHYDRATE IP BP USP

INR 188 INR 190
You Save 1.05%

VIEW DETAILS
pharma ATORVASTATIN CALCIUM IP/BP/EP/USP, intermediate ATORVASTATIN CALCIUM IP/BP/EP/USP, powder chemical ATORVASTATIN CALCIUM IP/BP/EP/USP,
ATORVASTATIN CALCIUM IP/BP/EP/USP

INR 2780 INR 2800
You Save 0.71%

VIEW DETAILS
MONOMETHYLAMINE, METHANAMINE imported ready stock available,
MONOMETHYLAMINE (METHANAMINE)

INR 108 INR 110
You Save 1.82%

VIEW DETAILS
Offering you high range of pharma IP BP USP grade chloride chemicals, pharma comply chloride chemicals, ip bp usp grade chloride chemicals with accurate composition and high quality ingredients in IndiaBarium Chloride IP/BP/USP,Calcium Chloride Dihydrate IP/BP/USP,Magnesium Chloride Hexahydrate IP BP USP,Potassium Chloride IP BP USP,Sodium Chloride IP BP USP PHARMA,
CHLORIDE PHARMA IP BP USP MANUFACTURER

INR 197 INR 200
You Save 1.5%

VIEW DETAILS
Manufacturer exporter & supplier of carbonate & bicarbonate IP BP USP pharma grade chemicals.Pharma comply carbonate chemicals, Pharma grade bicarbonate chemicals,Calcium Carbonate IP/BP/USP,Sodium Carbonate Anhydrous IP/BP/USP NF,Sodium Carbonate Monohydrate IP/BP/USP NF,Potassium Carbonate,Zinc Carbonate USP,Sodium Bicarbonate IP/BP/USP,
CARBONATES & BICARBONATES IP BP USP PH

INR 78 INR 80
You Save 2.5%

VIEW DETAILS
This medication is an iron supplement used to treat or prevent low blood levels of iron (such as those caused by anemia or pregnancy). Iron is an important mineral that the body needs to produce red blood cells and keep you in good health.
FERROUS SULPHATE DRIED IP BP USP

INR 26 INR 28
You Save 7.14%

VIEW DETAILS
Para tertiary butylphenol formaldehyde resin also known as p-tert-butylphenol-formaldehyde resin (PTBP-FR) or 4-(1,1-dimethylethyl) phenol (PTBP Formaldehyde) is a phenol-formaldehyde resin found in commercial adhesives, and in particular in adhesives used to bond leather and rubber.
Para tertiary butylphenol

INR 230 INR 250
You Save 8%

VIEW DETAILS
Offering high quality hand sanitizers, 5 liters packing, IPA - Isopropyl Alcohol & Ethanol - Ethyl Alcohol. Contact for bulk and small packing price.
5 Liters Hand Sanitizer SANI 711

INR 502 INR 520
You Save 3.46%

VIEW DETAILS
Polyvinylpyrrolidone Polymer (PVP): PVP K-30. Both the grades are hygroscopic and amorphous polymer. They are linear non-ionic polymers that are soluble in water and organic solvents and are pH stable. They forms hard glossy transparent films and have adhesive, cohesive and dispersive properties.Ashland Make Stock Available
Polyvinylpyrrolidone Polymer PVP K 30

INR 550

VIEW DETAILS
Valine is an α-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group, an α-carboxylic acid group, and a side chain isopropyl group, making it a non-polar aliphatic amino acid. It is essential in humans, meaning the body cannot synthesize it: it must be obtained from the diet.
L Valine
VIEW DETAILS
In addition to carbonated diet drinks, saccharin is used to sweeten low-calorie candies, jams, jellies, and cookies. It's also used in many medicines. Saccharin can be used similarly to table sugar to sprinkle onto food, such as cereal or fruit, or used as a sugar substitute in coffee or when baking.
SODIUM SACCHARIN
VIEW DETAILS
Agrochemical Category:Fungicide, HerbicideIndustry Uses:Adhesives and sealant chemicals Corrosion inhibitors and anti-scaling agents
Disodium Ethylenebis Dithiocarbamate
VIEW DETAILS
Benzisothiazolinone (BIT) is a widely used biocide and belongs to the group of isothiazolinones.Benzisothiazolinone has a microbicide and a fungicide mode of action. It is widely used as a preservative, for example in:-Emulsion paints, caulks, varnishes, adhesives, inks, and photographic processing solutions;-Home cleaning and car care products; laundry detergents, stain removers and fabric softeners;-Industrial settings, for example in textile spin-finish solutions, leather processing solutions, preservation of fresh animal hides and skins;-Agriculture in pesticide formulations;-Gas and oil drilling in muds and packer fluids preservation.
Benzisothiazolinone (BIT) 20%
VIEW DETAILS
1H-INDOLE-4-CARBOXALDEHYDE is a synthetic intermediate used for pharmaceutical synthesis
1H-INDOLE-4-CARBOXALDEHYDE
VIEW DETAILS
Acid slurry manufacturer in drums & carboys, vadodara
Acid slurry

INR 85

VIEW DETAILS
p-Divinylbenzene(DVB) is a cross-linking agent, which is used in a variety of polymeric processes such as copolymerization of styrene to improve the thermo-mechanical properties of the composite.
p-Divinylbenzene(DVB)
VIEW DETAILS
High quality cosmetic chemicals Tetrasodium glutamate diacetate available in stock
Tetrasodium glutamate diacetate

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
Offering high quality paracetamol powder, paracetamol BP USP PH EUR grade
Paracetamol Powder
VIEW DETAILS
Dodecyl Trimethyl Ammonium Chloride (DTAC)Hexadecyl Trimethyl Ammonium Chloride (HTAC)Octadecyl Trimethyl Ammonium Chloride (OTAC)Dioctyl dimethyl ammonium chloride (D0821)Di(OctylDecyl)Dimethyl Ammonium Chloride (D8021)Didecyl dimethyl ammonium chloride (D1021)Lauryl Dimethyl Amine Oxide (OA-12)DodecylTetradecyl Dimethyl Amine Oxide (OA-14)
Cationic surfactant

INR 199 INR 200
You Save 0.5%

VIEW DETAILS
Heilongjiang NHU Biotechnology make Ascorbic acid (Vitamin C) available in stock
Ascorbic acid (Vitamin C)
VIEW DETAILS
Offer to sell high quality Lithium Carbonate chemicals
Lithium Carbonate
VIEW DETAILS
Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
Foamaster Series Additives

INR 530 INR 550
You Save 3.64%

VIEW DETAILS
Methyl cinnamate (C10H10O2) is found in a variety of plants, such as basil, strawberries, and eucalyptus. Methyl cinnamate is used as a flavoring and as a fragrance, with a smell of cinnamon and strawberry. Methyl cinnamate has been investigated in its effect on food browning, specifically in mushrooms.
Methyl cinnamate
VIEW DETAILS
Mono-ethylene glycol - or MEG - is a vital ingredient for the production of polyester fibres and film, polyethylene terephthalate (PET) resins and engine coolants.End uses for MEG range from clothing and other textiles, through packaging to kitchenware, engine coolants and antifreeze. Polyester and fleece fabrics, upholstery, carpets and pillows, as well as light and sturdy polyethylene terephthalate drink and food containers originate from ethylene glycol. The humectant (water attracting) properties of MEG products also make them ideal for use in fibres treatment, paper, adhesives, printing inks, leather and cellophane.
Mono Ethylene Glycol

INR 58 INR 65
You Save 10.77%

VIEW DETAILS
IPA based gel hand sanitizers manufacturer with ingredients Glycerine, Aloevera Extract, Neem Extract, Turmeric Extract, Isopropyl Alcohol 70%, Gel Base, Perfume, Dm Water, highly effective against virus and bacterial
Hand Sanitizer

INR 480 INR 485
You Save 1.03%

VIEW DETAILS
We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
METHYL CYANOACETATE
VIEW DETAILS
Methylene Chloride (or dichloromethane) is a colourless volatile liquid with a sweet smell. It is extensively used as a chemical solvent. It is insoluble in water but miscible with organic solvents.Methylene Chloride is synthetically produced by reacting methyl chloride or methane with Chlorine gas at 400-5000C. Methane and methyl chloride undergo a series of chain reaction and yield chlorinated products progressively.Methylene Chloride (or Dichloromethane) volatility and its ability to dissolve with numerous organic compounds make it a useful organic solvent for many chemical processes. However, methylene chloride’s ill effect on health has forced the scientists to look for its alternatives.The applications of methylene chloride are: Major use in Pharmaceutical industry Manufacturing of Polycarbonates, Phenolics, Rayon yarn. Solvent for Cellulose Acetates, Photo-resist, Tablet film coatings. Paint and Grease Removing Agent. Fire-Fighting Agent. Extractant for Edible fats, Cocoa, Butter and Essences. Adhesives for Polymethyl Methacrylate. Aerosol Propellant, Refrigerant. Chemical Reaction Media. Low-temperature heat-transfer medium.
Methylene Dichloride

INR 62 INR 65
You Save 4.62%

VIEW DETAILS
We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
Cyanocobalamin Vitamin B12
VIEW DETAILS
Polymethyl Methacrylate PMMA or acrylic is a widely used transparent plastic material known for its applications in various markets from car windows, smartphone screens to aquariums. It is a tough plastic, easy to shape and a great alternative to the high cost and less resilient glass.GSFC make Polymethyl Methacrylate available at lowest price.
Polymethyl Methacrylate
VIEW DETAILS
It is a free flowing white crystals, very slightly soluble in water and in other acids.It is used in manufacturing of Titanium, and manufacturing of Aluminium Titanium Boron alloys for grain refining of aluminium metal. It increases the strength of aluminium metal and its alloy.
Potassium Hexafluorotitanate
VIEW DETAILS
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
Caustic Soda Flakes

INR 1599

VIEW DETAILS
We are one of the prominent manufacturers, exporters and suppliers of high quality Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical. Offered chemical is processed in a very hygienic environment by utilizing quality approved chemical substances. This chemical finds broad applications in cosmetic and soap industry for adding soothing fragrances. Further, this chemical is tested on various quality parameters to ensure its high effectiveness. Besides, our clients can obtain this Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical from us in different packaging options at nominal rates.Application in : Incense Sticks ( Agarbatti ), bakhoor, dhoop & loban, Fine Fragrances & Soap Perfumes, Detergent Powders, Cosmetics & Toiletries.
Yara Yara Beta Naphthyl Methyl Ether

INR 350 INR 360
You Save 2.78%

VIEW DETAILS
Our company has succeeded to achieve respectable position in the market by offering our clients Sodium Meta Silicate Anhydrous. Sodium metasilicate anhydrous is strongly alkaline, having strong capacity of cleaning, buffering and softening, counteracting acidic contamination, emulsifying fat and oil, deflocculating to inorganic. Sodium metasilicate anhydrous is an inorganic white powder or crystalline granules, non-toxic, tasteless and environment-safe. It is easy soluble in water, insoluble in alcohol or in acid producing an alkaline solution, very hygroscopic when reacting with CO2 and water from the air. Applications:Metal treatment chemicals,Ceramic Industrial ,DetergentCleaning powder,Specialty Chemicals
Sodium Metasilicate

INR 51 INR 55
You Save 7.27%

VIEW DETAILS
We are a manufacturer & suppliers of Lithium Acetate dihydrate, anhydrous & solution in India.Lithium acetate dihydrate is a salt of lithium and acetic acid. Lithium acetate dihydrate is used in ester interchange catalyst in polyester production, anticorrosion agent in molding polyphenylene sulfide resins, and a catalyst in alkyd resin and acrylic polymer production.
Lithium Acetate Anhydrous
VIEW DETAILS
Boron is an ideal Boron Fertilizer. It increases profit by maximizing yield. With sincere efforts, we have successfully been engaged in manufacturing and supplying a superior quality of (Boron-10%). This is processed with the use of boron chemicals and by the aid of sophisticated techniques under our adroit professionals. It is used in foliar and drip irrigation applications as insecticides, pesticides and fungicides. In addition to this, the offered (Boron-10%) is available in the market at reasonable prices from us.Benefits:It helps in new cell formation and root developmentIt helps in formation of protein and amino acidIncrease number of flowers and fruitEnsures growth and high yield of all cropRecommended Crops:Wheat, Maize, Sugarcane, Rice, Sorghum, Cotton, Pigeon Pea, Sunflower, Groundnut, Soybean, and Vegetables like Tomato, Brinjal, Chilly etc., all types of Fruits Crops and Tea & Coffee.
BORON 10%

INR 105 INR 110
You Save 4.55%

VIEW DETAILS
Formulated using Phosphorous 52% and Potassium 34%, Special NPK (00-52-34) is a 100% water soluble fertilizer which promotes the soil fertility. It is a great source of P & K soil nutrients for plants, specially useful during early and end stages of crop growth.Content:N (Nitrogen) : 00%P (Phosphorous): 52%K (Potassium) :34%Advantages:Complete Plant FoodHighest Nutrition ContentExcellent Chemical PropertiesSuitable For Fruit DevelopmentIt's Good Vegetative Development Gives Scope For Good YieldRecommended Crops:Cereals & Fibres ( Rice, Wheat, Maize, Cotton, etc.).Tomato, Onion, Potato, Groundnut, Sugar Beets, Legumes other Vegetables crops.Commercial crops like Sugarcane, Tea & Coffee, etc.Fruits ( Grapes, Mango, Apple, Banana, Citrus, Strawberry, Pomegranates etc.) and other fruits.Flower ( Roses, Marigold, Carnation, Gerbera etc.) & other flowers.Dosage & Application:Foliar Application:- 100 gm per pump or 15 litre water.Soil Application: - 5 kg per acre.Packing Available: 1 kg, 25 kg & Bulk.
NPK 00:52:34

INR 85 INR 90
You Save 5.56%

VIEW DETAILS
We are a importer & suppliers of 1, 2, 3 Benzotriazole (BTA) that is used in antirust oil (grease) products, widely used in air phase corrosion inhibitor and circulating water finishing agent in copper and copper alloy, motor vehicle antifreeze fluid, photo antifoggant, macromolecule stabilizer, plant growth regulator, lubricating oil additives, ultraviolet absorber etc. It can be also used with various antisludging agent and germicidal agent.
1, 2, 3 Benzotriazole (BTA)

INR 670 INR 680
You Save 1.47%

VIEW DETAILS
We are a importer & supplier of Gluconic Acid 50%.Gluconic acid is an organic compound with molecular formula C6H12O7 and condensed structural formula HOCH2(CHOH)4COOH. It is one of the 16 stereoisomers of 2,3,4,5,6-pentahydroxyhexanoic acid.Gluconic acid occurs naturally in fruit, honey, and wine. As a food additive, it is an acidity regulator. It is also used in cleaning products where it dissolves mineral deposits especially in alkaline solution. In aqueous solution at neutral pH, gluconic acid forms the gluconate ion. The salts of gluconic acid are known as
Gluconic Acid 50%

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
We are proficient in supplying a wide range of Anhydrous Ammonia that is largely utilized by our customers in nitrogen fertilizer. According to the convenience of the customers, we are delivering this chemical substance in a variety of cylinder sizes like 40, 50, 60 and 225 kg. So as to cater to the exact necessities of the users, we are supply this chemical pure forms varying from 95.5% to 98.5% in tankers and cylinders sizes.
Anhydrous Ammonia

INR 120 INR 125
You Save 4%

VIEW DETAILS
Buy high quality Chlorhexidine Gluconate 20% manufacturer, supplier, importer, dealer, distributor, trader, exporter from Vadodara, Gujarat, India & used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, chemical compound for pharmaceutical and chemicals process industry available at best price.
Chlorhexidine Gluconate 20% Solution B
VIEW DETAILS
Buy high quality Caustic Soda Flakes, Prills, & Lye gacl/meghmani/dcm make manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Caustic Soda Flakes, Prills, & Lye
VIEW DETAILS
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
2-Amino-5-chlorobenzophenone

INR 22000

VIEW DETAILS
Buy high quality ALBUTEROL SULPHATE manufacturer, exporter, suppliers for pharmaceutical, bulk drugs, intermediates in Vadodara, Gujarat, India.
ALBUTEROL SULPHATE
VIEW DETAILS
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Aceclofenac
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
N,N-Diisopropylethylenediamine
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
TRICHLOROISOCYANURIC ACID - TCCA 90%

INR 230 INR 235
You Save 2.13%

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
View Details
Lidocaine Base HCL IP BP
Emerged as a reputed Material & Service provider of the industry, we are engaged in rendering qualitative Various Floor Coating Material and Services.Epoxy FlooringPU FlooringUcrate FlooringMastic FlooringHeavy Screed Flooring3D FlooringMettalic FlooringDesigner FlooringMicro Chipping FlooringPolyUratha FlooringConductive / Anti Static FlooringHybrid Flooring
View Details
Floor and Wall Coating

INR 57 INR 58
You Save: INR 1 (1.72%)

2-Chloro-5-Nitrobenzoic Acid raw materials, powder manufacturer of nitrobenzoic acid
View Details
2-Chloro-5-Nitrobenzoic

INR 2480 INR 2500
You Save: INR 20 (0.8%)

TUNGSTATE CHEMICALS MANUFACTURER, TUNGSTATE PIGMENTS, TUNGSTATE SODIUM CHEMICALS, Tungsten Carbide PowderTungsten PowderPotassium TungstateSodium Tungstate HydrateTungstic AcidPhosphotungstic Acid HydrateSodium MetatungstateTungsten TrioxideSilicotungstic AcidTungsten DisulphideAmmonium Para TungstateAmmonium Meta TungstateCadmium tungstateCobalt TungstateCesium TungstateMagnesium TungstateBismuth Tungsten OxideManganese TungstateBarium Tungstate
View Details
TUNGSTATE CHEMICALS MANU

INR 335 INR 390
You Save: INR 55 (14.1%)

SILVER SULFADIAZINE STOCK, silver pharma chemicals, sulfadiazine pharma raw materials, Stock Available
View Details
SILVER SULFADIAZINE
Ethyl chemicals, acetate chemicals, bromide chemicalsEthyl acetateEthyl BromideEthyl cellosolveEthyl CelluloseEthyl Chlorideethyl chloroacetateEthyl Cyano Acetate (ECA)Ethyl Cyano Acrylate
View Details
ETHYL CHEMICALS

INR 253 INR 255
You Save: INR 2 (0.78%)

MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS pharma grade, bp MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS, usp MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS, ip MAGNESIUM SULPHATE MONOHYDRATE & ANHYDROUS
View Details
MAGNESIUM SULPHATE MONOH

INR 186 INR 188
You Save: INR 2 (1.06%)

medicinal CHROMIUM PICOLINATE USP, pharma grade CHROMIUM PICOLINATE USP, high quality CHROMIUM PICOLINATE USP, Chromium picolinate has been used in alternative medicine to treat chromium deficiency, as an aid to controlling blood sugar in people with diabetes or prediabetes, to lower cholesterol, and as a weight-loss supplement.
View Details
CHROMIUM PICOLINATE USP

INR 2278 INR 2280
You Save: INR 2 (0.09%)

pharma grade EDETATE DISODIUM DIHYDRATE IP BP USP, animal feed EDETATE DISODIUM DIHYDRATE IP BP, feed EDETATE DISODIUM DIHYDRATE USP, cosmetic EDETATE DISODIUM DIHYDRATE,
View Details
EDETATE DISODIUM DIHYDRA

INR 188 INR 190
You Save: INR 2 (1.05%)

pharma ATORVASTATIN CALCIUM IP/BP/EP/USP, intermediate ATORVASTATIN CALCIUM IP/BP/EP/USP, powder chemical ATORVASTATIN CALCIUM IP/BP/EP/USP,
View Details
ATORVASTATIN CALCIUM IP/

INR 2780 INR 2800
You Save: INR 20 (0.71%)

MONOMETHYLAMINE, METHANAMINE imported ready stock available,
View Details
MONOMETHYLAMINE (METHANA

INR 108 INR 110
You Save: INR 2 (1.82%)

Offering you high range of pharma IP BP USP grade chloride chemicals, pharma comply chloride chemicals, ip bp usp grade chloride chemicals with accurate composition and high quality ingredients in IndiaBarium Chloride IP/BP/USP,Calcium Chloride Dihydrate IP/BP/USP,Magnesium Chloride Hexahydrate IP BP USP,Potassium Chloride IP BP USP,Sodium Chloride IP BP USP PHARMA,
View Details
CHLORIDE PHARMA IP BP US

INR 197 INR 200
You Save: INR 3 (1.5%)

Manufacturer exporter & supplier of carbonate & bicarbonate IP BP USP pharma grade chemicals.Pharma comply carbonate chemicals, Pharma grade bicarbonate chemicals,Calcium Carbonate IP/BP/USP,Sodium Carbonate Anhydrous IP/BP/USP NF,Sodium Carbonate Monohydrate IP/BP/USP NF,Potassium Carbonate,Zinc Carbonate USP,Sodium Bicarbonate IP/BP/USP,
View Details
CARBONATES & BICARBONATE

INR 78 INR 80
You Save: INR 2 (2.5%)

This medication is an iron supplement used to treat or prevent low blood levels of iron (such as those caused by anemia or pregnancy). Iron is an important mineral that the body needs to produce red blood cells and keep you in good health.
View Details
FERROUS SULPHATE DRIED I

INR 26 INR 28
You Save: INR 2 (7.14%)

Para tertiary butylphenol formaldehyde resin also known as p-tert-butylphenol-formaldehyde resin (PTBP-FR) or 4-(1,1-dimethylethyl) phenol (PTBP Formaldehyde) is a phenol-formaldehyde resin found in commercial adhesives, and in particular in adhesives used to bond leather and rubber.
View Details
Para tertiary butylpheno

INR 230 INR 250
You Save: INR 20 (8%)

Offering high quality hand sanitizers, 5 liters packing, IPA - Isopropyl Alcohol & Ethanol - Ethyl Alcohol. Contact for bulk and small packing price.
View Details
5 Liters Hand Sanitizer

INR 502 INR 520
You Save: INR 18 (3.46%)

Polyvinylpyrrolidone Polymer (PVP): PVP K-30. Both the grades are hygroscopic and amorphous polymer. They are linear non-ionic polymers that are soluble in water and organic solvents and are pH stable. They forms hard glossy transparent films and have adhesive, cohesive and dispersive properties.Ashland Make Stock Available
View Details
Polyvinylpyrrolidone Pol

INR 550

Valine is an α-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group, an α-carboxylic acid group, and a side chain isopropyl group, making it a non-polar aliphatic amino acid. It is essential in humans, meaning the body cannot synthesize it: it must be obtained from the diet.
View Details
L Valine
In addition to carbonated diet drinks, saccharin is used to sweeten low-calorie candies, jams, jellies, and cookies. It's also used in many medicines. Saccharin can be used similarly to table sugar to sprinkle onto food, such as cereal or fruit, or used as a sugar substitute in coffee or when baking.
View Details
SODIUM SACCHARIN
Agrochemical Category:Fungicide, HerbicideIndustry Uses:Adhesives and sealant chemicals Corrosion inhibitors and anti-scaling agents
View Details
Disodium Ethylenebis Dit
Benzisothiazolinone (BIT) is a widely used biocide and belongs to the group of isothiazolinones.Benzisothiazolinone has a microbicide and a fungicide mode of action. It is widely used as a preservative, for example in:-Emulsion paints, caulks, varnishes, adhesives, inks, and photographic processing solutions;-Home cleaning and car care products; laundry detergents, stain removers and fabric softeners;-Industrial settings, for example in textile spin-finish solutions, leather processing solutions, preservation of fresh animal hides and skins;-Agriculture in pesticide formulations;-Gas and oil drilling in muds and packer fluids preservation.
View Details
Benzisothiazolinone (BIT
1H-INDOLE-4-CARBOXALDEHYDE is a synthetic intermediate used for pharmaceutical synthesis
View Details
1H-INDOLE-4-CARBOXALDEHY
Acid slurry manufacturer in drums & carboys, vadodara
View Details
Acid slurry

INR 85

p-Divinylbenzene(DVB) is a cross-linking agent, which is used in a variety of polymeric processes such as copolymerization of styrene to improve the thermo-mechanical properties of the composite.
View Details
p-Divinylbenzene(DVB)
High quality cosmetic chemicals Tetrasodium glutamate diacetate available in stock
View Details
Tetrasodium glutamate di

INR 75 INR 80
You Save: INR 5 (6.25%)

Offering high quality paracetamol powder, paracetamol BP USP PH EUR grade
View Details
Paracetamol Powder
Dodecyl Trimethyl Ammonium Chloride (DTAC)Hexadecyl Trimethyl Ammonium Chloride (HTAC)Octadecyl Trimethyl Ammonium Chloride (OTAC)Dioctyl dimethyl ammonium chloride (D0821)Di(OctylDecyl)Dimethyl Ammonium Chloride (D8021)Didecyl dimethyl ammonium chloride (D1021)Lauryl Dimethyl Amine Oxide (OA-12)DodecylTetradecyl Dimethyl Amine Oxide (OA-14)
View Details
Cationic surfactant

INR 199 INR 200
You Save: INR 1 (0.5%)

Heilongjiang NHU Biotechnology make Ascorbic acid (Vitamin C) available in stock
View Details
Ascorbic acid (Vitamin C
Offer to sell high quality Lithium Carbonate chemicals
View Details
Lithium Carbonate
Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
View Details
Foamaster Series Additiv

INR 530 INR 550
You Save: INR 20 (3.64%)

Methyl cinnamate (C10H10O2) is found in a variety of plants, such as basil, strawberries, and eucalyptus. Methyl cinnamate is used as a flavoring and as a fragrance, with a smell of cinnamon and strawberry. Methyl cinnamate has been investigated in its effect on food browning, specifically in mushrooms.
View Details
Methyl cinnamate
Mono-ethylene glycol - or MEG - is a vital ingredient for the production of polyester fibres and film, polyethylene terephthalate (PET) resins and engine coolants.End uses for MEG range from clothing and other textiles, through packaging to kitchenware, engine coolants and antifreeze. Polyester and fleece fabrics, upholstery, carpets and pillows, as well as light and sturdy polyethylene terephthalate drink and food containers originate from ethylene glycol. The humectant (water attracting) properties of MEG products also make them ideal for use in fibres treatment, paper, adhesives, printing inks, leather and cellophane.
View Details
Mono Ethylene Glycol

INR 58 INR 65
You Save: INR 7 (10.77%)

IPA based gel hand sanitizers manufacturer with ingredients Glycerine, Aloevera Extract, Neem Extract, Turmeric Extract, Isopropyl Alcohol 70%, Gel Base, Perfume, Dm Water, highly effective against virus and bacterial
View Details
Hand Sanitizer

INR 480 INR 485
You Save: INR 5 (1.03%)

We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
View Details
METHYL CYANOACETATE
Methylene Chloride (or dichloromethane) is a colourless volatile liquid with a sweet smell. It is extensively used as a chemical solvent. It is insoluble in water but miscible with organic solvents.Methylene Chloride is synthetically produced by reacting methyl chloride or methane with Chlorine gas at 400-5000C. Methane and methyl chloride undergo a series of chain reaction and yield chlorinated products progressively.Methylene Chloride (or Dichloromethane) volatility and its ability to dissolve with numerous organic compounds make it a useful organic solvent for many chemical processes. However, methylene chloride’s ill effect on health has forced the scientists to look for its alternatives.The applications of methylene chloride are: Major use in Pharmaceutical industry Manufacturing of Polycarbonates, Phenolics, Rayon yarn. Solvent for Cellulose Acetates, Photo-resist, Tablet film coatings. Paint and Grease Removing Agent. Fire-Fighting Agent. Extractant for Edible fats, Cocoa, Butter and Essences. Adhesives for Polymethyl Methacrylate. Aerosol Propellant, Refrigerant. Chemical Reaction Media. Low-temperature heat-transfer medium.
View Details
Methylene Dichloride

INR 62 INR 65
You Save: INR 3 (4.62%)

We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
View Details
Cyanocobalamin Vitamin B
Polymethyl Methacrylate PMMA or acrylic is a widely used transparent plastic material known for its applications in various markets from car windows, smartphone screens to aquariums. It is a tough plastic, easy to shape and a great alternative to the high cost and less resilient glass.GSFC make Polymethyl Methacrylate available at lowest price.
View Details
Polymethyl Methacrylate
It is a free flowing white crystals, very slightly soluble in water and in other acids.It is used in manufacturing of Titanium, and manufacturing of Aluminium Titanium Boron alloys for grain refining of aluminium metal. It increases the strength of aluminium metal and its alloy.
View Details
Potassium Hexafluorotita
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
View Details
Caustic Soda Flakes

INR 1599

We are one of the prominent manufacturers, exporters and suppliers of high quality Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical. Offered chemical is processed in a very hygienic environment by utilizing quality approved chemical substances. This chemical finds broad applications in cosmetic and soap industry for adding soothing fragrances. Further, this chemical is tested on various quality parameters to ensure its high effectiveness. Besides, our clients can obtain this Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical from us in different packaging options at nominal rates.Application in : Incense Sticks ( Agarbatti ), bakhoor, dhoop & loban, Fine Fragrances & Soap Perfumes, Detergent Powders, Cosmetics & Toiletries.
View Details
Yara Yara Beta Naphthyl

INR 350 INR 360
You Save: INR 10 (2.78%)

Our company has succeeded to achieve respectable position in the market by offering our clients Sodium Meta Silicate Anhydrous. Sodium metasilicate anhydrous is strongly alkaline, having strong capacity of cleaning, buffering and softening, counteracting acidic contamination, emulsifying fat and oil, deflocculating to inorganic. Sodium metasilicate anhydrous is an inorganic white powder or crystalline granules, non-toxic, tasteless and environment-safe. It is easy soluble in water, insoluble in alcohol or in acid producing an alkaline solution, very hygroscopic when reacting with CO2 and water from the air. Applications:Metal treatment chemicals,Ceramic Industrial ,DetergentCleaning powder,Specialty Chemicals
View Details
Sodium Metasilicate

INR 51 INR 55
You Save: INR 4 (7.27%)

We are a manufacturer & suppliers of Lithium Acetate dihydrate, anhydrous & solution in India.Lithium acetate dihydrate is a salt of lithium and acetic acid. Lithium acetate dihydrate is used in ester interchange catalyst in polyester production, anticorrosion agent in molding polyphenylene sulfide resins, and a catalyst in alkyd resin and acrylic polymer production.
View Details
Lithium Acetate Anhydrou
Boron is an ideal Boron Fertilizer. It increases profit by maximizing yield. With sincere efforts, we have successfully been engaged in manufacturing and supplying a superior quality of (Boron-10%). This is processed with the use of boron chemicals and by the aid of sophisticated techniques under our adroit professionals. It is used in foliar and drip irrigation applications as insecticides, pesticides and fungicides. In addition to this, the offered (Boron-10%) is available in the market at reasonable prices from us.Benefits:It helps in new cell formation and root developmentIt helps in formation of protein and amino acidIncrease number of flowers and fruitEnsures growth and high yield of all cropRecommended Crops:Wheat, Maize, Sugarcane, Rice, Sorghum, Cotton, Pigeon Pea, Sunflower, Groundnut, Soybean, and Vegetables like Tomato, Brinjal, Chilly etc., all types of Fruits Crops and Tea & Coffee.
View Details
BORON 10%

INR 105 INR 110
You Save: INR 5 (4.55%)

Formulated using Phosphorous 52% and Potassium 34%, Special NPK (00-52-34) is a 100% water soluble fertilizer which promotes the soil fertility. It is a great source of P & K soil nutrients for plants, specially useful during early and end stages of crop growth.Content:N (Nitrogen) : 00%P (Phosphorous): 52%K (Potassium) :34%Advantages:Complete Plant FoodHighest Nutrition ContentExcellent Chemical PropertiesSuitable For Fruit DevelopmentIt's Good Vegetative Development Gives Scope For Good YieldRecommended Crops:Cereals & Fibres ( Rice, Wheat, Maize, Cotton, etc.).Tomato, Onion, Potato, Groundnut, Sugar Beets, Legumes other Vegetables crops.Commercial crops like Sugarcane, Tea & Coffee, etc.Fruits ( Grapes, Mango, Apple, Banana, Citrus, Strawberry, Pomegranates etc.) and other fruits.Flower ( Roses, Marigold, Carnation, Gerbera etc.) & other flowers.Dosage & Application:Foliar Application:- 100 gm per pump or 15 litre water.Soil Application: - 5 kg per acre.Packing Available: 1 kg, 25 kg & Bulk.
View Details
NPK 00:52:34

INR 85 INR 90
You Save: INR 5 (5.56%)

We are a importer & suppliers of 1, 2, 3 Benzotriazole (BTA) that is used in antirust oil (grease) products, widely used in air phase corrosion inhibitor and circulating water finishing agent in copper and copper alloy, motor vehicle antifreeze fluid, photo antifoggant, macromolecule stabilizer, plant growth regulator, lubricating oil additives, ultraviolet absorber etc. It can be also used with various antisludging agent and germicidal agent.
View Details
1, 2, 3 Benzotriazole (B

INR 670 INR 680
You Save: INR 10 (1.47%)

We are a importer & supplier of Gluconic Acid 50%.Gluconic acid is an organic compound with molecular formula C6H12O7 and condensed structural formula HOCH2(CHOH)4COOH. It is one of the 16 stereoisomers of 2,3,4,5,6-pentahydroxyhexanoic acid.Gluconic acid occurs naturally in fruit, honey, and wine. As a food additive, it is an acidity regulator. It is also used in cleaning products where it dissolves mineral deposits especially in alkaline solution. In aqueous solution at neutral pH, gluconic acid forms the gluconate ion. The salts of gluconic acid are known as
View Details
Gluconic Acid 50%

INR 75 INR 80
You Save: INR 5 (6.25%)

We are proficient in supplying a wide range of Anhydrous Ammonia that is largely utilized by our customers in nitrogen fertilizer. According to the convenience of the customers, we are delivering this chemical substance in a variety of cylinder sizes like 40, 50, 60 and 225 kg. So as to cater to the exact necessities of the users, we are supply this chemical pure forms varying from 95.5% to 98.5% in tankers and cylinders sizes.
View Details
Anhydrous Ammonia

INR 120 INR 125
You Save: INR 5 (4%)

Buy high quality Chlorhexidine Gluconate 20% manufacturer, supplier, importer, dealer, distributor, trader, exporter from Vadodara, Gujarat, India & used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, chemical compound for pharmaceutical and chemicals process industry available at best price.
View Details
Chlorhexidine Gluconate
Buy high quality Caustic Soda Flakes, Prills, & Lye gacl/meghmani/dcm make manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Caustic Soda Flakes, Pri
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
View Details
2-Amino-5-chlorobenzophe

INR 22000

Buy high quality ALBUTEROL SULPHATE manufacturer, exporter, suppliers for pharmaceutical, bulk drugs, intermediates in Vadodara, Gujarat, India.
View Details
ALBUTEROL SULPHATE
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Aceclofenac
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
View Details
N,N-Diisopropylethylened
Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
View Details
TRICHLOROISOCYANURIC ACI

INR 230 INR 235
You Save: INR 5 (2.13%)

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share