OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products supplier

Our Manufacturer

supplier
BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
Basf Plantacare Series 2000/1200/818/8

INR 350

VIEW DETAILS
N-Methylmorpholine is the organic compound with the formula O(CH2CH2)2NCH3. It is a colorless liquid. It is a cyclic tertiary amine. It is used as a base catalyst for generation of polyurethanes and other reactions.
N-Methylmorpholine

INR 430 INR 450
You Save 4.44%

VIEW DETAILS
DIISOPROPYLAMINE used in agro, packaging, food & other industries.
DIISOPROPYLAMINE

INR 180 INR 200
You Save 10%

VIEW DETAILS
Benzyltriethylammonium chloride is a lipophilic phase-transfer catalyst that can be used in phase-transfer catalysis (PTC) to catalyze polycondensation reactions to form high molecular weight polymers under bi-phasic conditions.
Benzyltriethylammonium chloride

INR 365 INR 385
You Save 5.19%

VIEW DETAILS
We are a leading supplier & manufacturer of behentrimonium chloride used in cosmetic and hair care industry.
Behentrimonium chloride
VIEW DETAILS
The primary use of acrylic acid is in the production of acrylic esters and resins, which are used primarily in coatings and adhesives. It is also used in oil treatment chemicals, detergent intermediates, water treatment chemicals, and water absorbent polyacrylic acid polymers.
Acrylic Acid

INR 72 INR 75
You Save 4%

VIEW DETAILS
Handwash Concentrate in carboys & drums packing, readymade Handwash Concentrate, top quality Handwash Concentrate
Handwash Concentrate
VIEW DETAILS
Best quality White Phenyl Concentrate ready to use compound available at lowest price. Ready to use phenyl Concentrate.
White Phenyl Concentrate
VIEW DETAILS
Poly aluminium chloride liquid 9%, 14%, 17% in tanker load and carboys packing
Poly aluminium chloride liquid 9%, 14%

INR 32

VIEW DETAILS
Dodecyltrimethylammonium Bromide, Dodecyltrimethylammonium Bromide is a quaternary ammonium salt useful as paint strippers, foaming stabilizers, and bactericidal lotions.Chemical Propertieswhite to slightly yellow powder
Dodecyltrimethylammonium Bromide

INR 2300 INR 2500
You Save 8%

VIEW DETAILS
Comparative study between 1-propanol, 2-propanol & mecetronium ethyl sulfate (sterillium) hand-rub and chlorhexidine gluconate (microshield) hand-scrub for surgical hand disinfection.Two popular hand disinfectant solutions based on different principles and mechanisms of action were compared as to their ability to eradicate aerobic bacteria and their duration of action. Forty participants were chosen randomly forming two groups. Group A employed the hand scrub method using chlorhexidine (Microshield) and Group B the hand rub method using 1-propanol, 2-propanol and mecetronium ethyl sulfate (Sterillium). Culture swabs were taken from a 25 sq cm area over the palm before, immediately after and two hours after disinfection. The results showed an average of 50,000 colony forming units (CFUs) of bacterial species among the participants before hand disinfection. No bacterial growth was noted immediately after hand disinfection. However, two hours later there were 8 out of 20 (40 percent) positive growth for Group A (30,000 to 70,000 CFUs) and 4 out of 20 (20 percent) positive growth for Group B (40,000 to 70,000 CFUs).Mecetronium ethylsulfate, Mecetronium etilsulfate, Mecetronium ethyl sulfate, Mecetronii etilsulfas [Latin], Mecetronium ethylsulfate [USAN], Etilsulfate de mecetronium [French], Etilsulfato de mecetronio [Spanish], EINECS 221-106-5, Mecetronium ethylsulfate (USAN/INN), Cetyl-ethyl-dimethyl-ammonium ethosulfat, Ethylhexadecyldimethylammonium ethyl sulfate, D04871, 1-Hexadecanaminium, N-ethyl-N,N-dimethyl-, ethyl sulfate, 3006-10-8, 50641-13-9
Mecetronium ethylsulfate

INR 3100 INR 4000
You Save 22.5%

VIEW DETAILS
GACL - POLY ALUMINIUM CHLORIDE, A top water treatment chemical powder used in various water treatment application, better alternative of ferric and non ferric alum. Used in Municipal water treatmentSewage water treatementPulp & paper industry Decolorisation & Decontamination of dyes in textile industry
Poly Aluminium Chloride

INR 19 INR 22
You Save 13.64%

VIEW DETAILS
We are premium 4’ CHLOROPROPIOPHENONE supplier, manufacturer and exporter in India. Synonyms: 1-(4-chlorophenyl)-1-propanone
4'-Chloropropiophenone
VIEW DETAILS
Ethyl cyanoacetate is an organic compound that contains a carboxylate ester and a nitrile. It is a colourless liquid with a pleasant odor. This material is useful as a starting material for synthesis due to its variety of functional groups and chemical reactivity.
Ethyl cyanoacetate
VIEW DETAILS
We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
METHYL CYANOACETATE
VIEW DETAILS
Asbestos Powder that we manufacturer is best available quality that anyone can get in India. Our major Product Market is Bharuch, Ankleshwar, Surat, Vadodara, Gujarat , India.. Please Call for best price.We are identified as one of the leading manufacturers, suppliers, wholesalers and exporters of premium quality Asbestos Powder. To provide finest quality, this powder is processed using high quality ingredients that are sourced from certified vendors of the market. We thoroughly check this powder on various parameters like shelf life and precise composition.Features:PurityLonger shelf lifePrecise composition
ASBESTOS POWDER
VIEW DETAILS
Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
Mastertile 25 Grey

INR 469 INR 475
You Save 1.26%

VIEW DETAILS
2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE, drug intermediates, pharma intermediates available at best rate
2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE
VIEW DETAILS
Glycerine CP, Glycerine IP, VVF, Adani Wilmar, Godrej available in bulk and small packing from Vadodara, Gujarat, India.
Glycerine
VIEW DETAILS
Methyl isobutyl ketone (MIBK) is the organic compound with the formula (CH3)2CHCH2C(O)CH3. This colourless liquid, a ketone, is used as a solvent for gums, resins, paints, varnishes, lacquers, and nitrocellulose.
Methyl isobutyl ketone (MIBK)
VIEW DETAILS
GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPIt is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product. CAS No. 38899-05-7
GLUCOSAMINE SULPHATE SODIUM CHLORIDE-
VIEW DETAILS
It is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product.
GLUCOSAMINE HYDROCHLORIDE USP
VIEW DETAILS
Acesulfame potassium is a calorie-free sweetener that has been used in foods and beverages around the world for 15 years. The ingredient, which is 200 times sweeter than sugar, has been used in numerous foods in the United States since 1988, it is used in such products as candies, baked goods, frozen desserts, beverages, dessert mixes and tabletop sweeteners. Acesulfame potassium, which is also known as acesulfame K, is often used in combination with other low-calorie sweeteners because it enhances the sweet taste of foods and beverages.
Acesulfame Potassium

INR 825 INR 950
You Save 13.16%

VIEW DETAILS
We leading surplus & non moving, byproduct, waste grade chemicals & pharmaceutical, apis, drugs, solvents stock buyer & seller based at Vadodara, Vapi, Ankleshwar, Mumbai, Pune, Ahmedabad, Gujarat, India since 2009. We have following surplus chemicals in stock at our Gujarat, India location.Acetic Acid Glacial/pharma/commercial - 100 MtSulpuric Acid Commercial - 200 Mt SurplusNitric Acid Commercial - 100 Mt Surplus Acid ChemicalsSoda Ash Tata/nirma - 45 Mt SurplusCitric Acid China - 30 Mt SurplusEthyl Acetate Tanker - 50 Pvc Drums;42 Kg.Toluene Pass 92 % Moisture 0.8%1 , 4 Dioaxan /pure/ Gc 99.78%/kf 0.2% / 35 Drum/Ipa Cbm Gc 99.9% /kf 12% Water White/ph Neutral/ Tanker Load /qnty 16mt/Methanol Distilled / White/d .0.80/ph Neutral/200 DrumMono Ethyl Amine 70%N Propanol Amine 30 Pvc DrumsFormic AcidToluene Recovered No Smell - 99 % Ms DrumPottasium Sulphate 99%+ 5 Mt /off Whitwhite/99%/powder Form/50 Kg PackingOliec AcidMaliec AnhydrideIso Amyl AlcohalSodium Methoxide PowderSodium Methoxide PowderSodium Methoxide PowderTetra Butyl Ammonium Bro.Tetra Butyl Ammonium Bro.2-5 Di Bromo Pyridine4-cyano PyridineIso Nicotinic AcidP0cl3Nicotinic AcidRuthenium 5% AlluminaTri Ethyl AmineZinc DustMalic AcidAmmonium Chloride2, 6 Dimethyl AnilineTitanium ButoxideActivated Carbon Acg GradeCalcium HydroxideCrotonaldehydeAceton RecoverdDenatonium SaccharideActivated CarbonOxalic AcidBromineIsonicotinic Acid (Comm-gr)Sodium SulphatePottasium Carbonate4-fluoro-2-methoxyaniline4-bromo-2, 6-difluorobenzaldehyde2-bromo-5-fluorobenzoic AcidHydroxylamine HydrochlorideBarbituric AcidAmmonium AcetateDiethyl Amino Malonate HclLithium ChloridePhosphorous OxychlorideVinyl AcetateMethane SulfonamideSodium Bis(2-methoxyethoxy)aluminium HydrideDiethyl Oxalate2-ethylbutyric AcidCopper(Ii)sulphateIsopropyl Magnesium Chloride(2m In Thf)Isopropyl Magnesium Chloride(2m In Thf)MorpholineTrifluoromethane Sulfonic AnhydrideTrifluoromethane Sulfonic AnhydrideIron(Iii)nitrate NonahydrateTin PowderSodium Tert-pentoxideIron(Metal) PowderZinc Dust PowderThioureaFormamidine AcetateHydrazine Hydrate-80%3-methyl-2-butanoneAmmonium Bi CarbonateDimethylamine Hydrochloride
Surplus Chemicals & Pharmaceuticals

INR 2100 INR 2200
You Save 4.55%

VIEW DETAILS
White to Almost Praziquantel white crystalline powder as per IP/BP/EP/USP available.We Pure Chem Pvt Ltd, an ISO 9001:2008 certified APIs and Intermediates manufacturer, supplying Key veterinary APIs like Prazequantel IP/BP/EP/USP for domestic as well as export market.We are now in a field of Veterinary APIs, to offer Key APIs like Prazequantel IP/BP/EP/USP
Praziquantel

INR 8400 INR 8500
You Save 1.18%

VIEW DETAILS
We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
Cyanocobalamin Vitamin B12
VIEW DETAILS
Klucel hydroxypropyl cellulose (HPC) is a nonionic water-soluble cellulose ether with a remarkable combination of properties. It combines organic solvent solubility, thermoplasticity and surface activity with the aqueous thickening and stabilizing properties characteristic of other water-soluble cellulose polymers available from Ashland. Klucel HPC films are flexible without plasticizers and non-tacky at high humidity.
Klucel hydroxypropylcellulose
VIEW DETAILS
Manufacturer, exporter & suppliers of Lithium Chloride Solution 40% and 50% from Gujarat. Description - Light Yellow colored solution (Lithium Chloride Solution 40%)Specific Gravity at 25C g/cm3 260 – 1.262Assay (by Titration, %) Wt. % 40.00 Min.Alkalinity as LiOH (%) Wt. % 0.1 Max.Inhibitor (Na2CrO4) Wt. % 0.6 + 0.05Calcium (Ca, %) Wt. % 0.006 Max.Magnesium (Mg, %) Wt. % 0.0004 MaxSulphate (SO4, %) Wt. % 0.002 Max.
Lithium Chloride Solution
VIEW DETAILS
Composite acrylic polymer based cementitious crack resistant flexible waterproofing coating, MoistureZero is formulated specially for use in combination with all kinds of cement blends.It is to be used in cementitious slurries as a polymerizing agent and modifier to enhance durability of slurry against moisture ingress along with resistance to hair line cracks.Better performance as compared to similar products like Tapecrete P151 or others.Sunken areasWater bodiesTerraces where roof garden not presentCoverage:It depends on the substrate type (smooth or rough) and application skills.On Smooth Concrete 1Kg / 2 Coats / 15-20 Sq. FtOn Smooth Concrete 1Kg /3 Coats with Fibre layer / 8-12 Sq. Ft
BUILDSMART BS MoistureZero

INR 235 INR 252
You Save 6.75%

VIEW DETAILS
High quality ACITRETIN pharma neutraceuticals available with us. We are a self importer of this products in 1 kg & 5 kgs packing. Available in stock
ACITRETIN
VIEW DETAILS
Foremost 310 Crystalline Monohydrate available for pharmaceutical industry, pharma excipients, food and cosmetic industry. Crystalline Monohydrate Foremost 310 is a brand name of KERRY Ingredient USA. We are a suppliers and importers of Kerry Ingredients USA.
Crystalline Monohydrate [Foremost 310]
VIEW DETAILS
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
Caustic Soda Flakes

INR 1599

VIEW DETAILS
IUPAC Name: 2-Isocyanato-1,3-dimethylbenzene Empirical Formula: C9H9NO Molecular Weight: 147.1739 Freely Rotating Bonds: 1 Polar Surface Area: 29.43 Å2 Index of Refraction: 1.515 Molar Refractivity: 45 cm3 Molar Volume: 149 cm3 Polarizability: 17.84× 10-24 cm3 Surface Tension: 33 dyne/cm Density: 0.98 g/cm3 Flash Point: 74.5 °C Enthalpy of Vaporization: 44.19 kJ/mol Boiling Point: 205.6 °C at 760 mmHg Vapour Pressure: 0.247 mmHg at 25°C
2, 6-Dimethylphenyl isocyanate
VIEW DETAILS
Ichthammol is also called Ichthammolum. Chemically called Ammonium Ichthosulfonate or Ammonium Bituminosulfonate. Ichthammol is the ammonium salt of dark sulfonated shale oil. Ammonium Bituminosulfonate is used successfully as active pharmaceutical ingredient(API) of natural origin for more than 10 decades for the treatment of skin diseases.Technically, Ichthammol is a mixture of many different compounds. Not only singe substance.Chemically, Ammonium Bituminosulfonate is a sulfonated shale oil which is incompatible with acids, alkali carbonates or hydrates and alkaloidal salts. Ichthammol is a thick reddish brown liquid, with a bituminous odor and taste. Ammonium Bituminosulfonate is soluble in water and miscible with glycerol. However, Ichthammol is almost insoluble in strong alcohol or concentrated ether. Ammonium Ichthosulfonate contains a large percentage of organically combined sulfur.
Ammonium Ichthosulphonate

INR 2920 INR 2950
You Save 1.02%

VIEW DETAILS
It is used as a flame retardant in ABS, other plastics and yarn, a flocculant in the production of titanium dioxide and in the production of glass, paint and adhesives. It is also used as an ion-exchange resin for a number if cations in acidic solution including Na+ and as a polymerization and oxidation catalyst.
Antimony Trioxide Powder
VIEW DETAILS
The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
Zeolite 4A

INR 22 INR 25
You Save 12%

VIEW DETAILS
Lithium Carbonate Manufacturer Lithium carbonate is an inorganic compound, the lithium salt of carbonate with the formula Li2CO3This white salt is widely used in the processing of metal oxides.For the treatment of bipolar disorder, it is on the World Health Organization's List of Essential Medicines, the most important medications needed in a basic health system.Other names : Dilithium carbonate, Carbolith, Cibalith-S, Duralith, Eskalith, Lithane, Lithizine, Lithobid, Lithonate, Lithotabs Priadel, ZabuyeliteCAS Registry Number: 554-13-2Chemical formula : Li2CO3
Lithium Carbonate
VIEW DETAILS
We are a manufacturer & supplier of Zinc Sulphate Heptahydrate zn 21% in India.As Mordant in Calico-Printing; Preserving Wood & Skins; with Hypcochlorite for Bleaching Paper, Manufacturing Lithopone & other Zinc Salts; Clarifying Glue; Electrodepositing Zn; also as reagent in analytical Chemistry.
Zinc Sulphate Heptahydrate

INR 34 INR 42
You Save 19.05%

VIEW DETAILS
Pat Impex is a leading importer and supplier of Polyvinyl Chloride PVC Resin. We are a importer of Polyvinyl Chloride PVC Resin from Thailand, Gulf Countries, LG, Hanwha, ocean, georgia, ineos in India.
Polyvinyl Chloride PVC Resin
VIEW DETAILS
Buy high quality Vardenafil Hcl Trihydrate manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, textile, chemical compound for pharmaceutical and chemicals process industry available at best price.
Vardenafil Hcl Trihydrate
VIEW DETAILS
Buy high quality Povidone Iodine manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, textile, chemical compound for pharmaceutical and chemicals process industry available at best price.
Povidone Iodine
VIEW DETAILS
Buy high quality polyelectrolyte (Grade - Anionic, Cationic, Non Ionic) manufacturer, supplier, exporter, importer, dealer based at Vadodara, Gujarat, India for waste water treatment, etp treatment, water purification, oil recovery, color removal, paper making, mineral processing. It has anionic emulsions and dry polyacrylamides which can be used wherever liquid/solids separation is needed in industrial effluent treatment applications.
Polyelectrolyte
VIEW DETAILS
Leading exporter, manufacturer, supplier, dealer & distributor of Hydrochloric Acid - HCL chemicals in Tanker Load, Carboys packing and export packing from Vadodara, Gujarat, India. Hydrochloric Acid - 32-33% Hydrochloric Acid HCL - Surplus & By product grade also available.
HYDROCHLORIC ACID
VIEW DETAILS
Peracetic acid is an environmentally safe and versatile anti-microbial agent and a powerful antioxidant. It emits oxygen at lower temperatures than other bleaching agents. It is effective against micro-organisms and is not deactivated by catalase and peroxidase, the enzymes that break down hydrogen peroxide. It is widely used in food applications.Dairies, wineries, breweries and beverage plants,Meat and poultry processing and packaging,Milk and dairy products processing and packaging plants,Seafood and produce processing and packaging plants,Food processing and packaging plants,Egg processing and packaging equipment surfaces,Eating establishments
Peracetic acid
VIEW DETAILS
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
Isopropyl Alcohol
VIEW DETAILS
Best high quality Chlorhexidine Acetate BP/EP/USP made from fresh and quality raw material. We are one of the leading manufacturer & exporter from India. With the strong knowledge of this domain, our chemists support our firm to offer Chlorhexidine Acetate. The provided chemical is used for treating fungus and bacterial infection, this solution is also tested on set qualitative parameters to ensure their effectiveness. Furthermore, clients can avail this Chlorhexidine Acetate from us in various packaging options at economical prices.Features:Excellent Antiseptic High effectivenessZero side effectsLonger shelf life
Chlorhexidine Acetate BP/EP/USP
VIEW DETAILS
Buy high quality Chlorhexidine Gluconate 20% manufacturer, supplier, importer, dealer, distributor, trader, exporter from Vadodara, Gujarat, India & used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, chemical compound for pharmaceutical and chemicals process industry available at best price.
Chlorhexidine Gluconate 20% Solution B
VIEW DETAILS
Buy high quality Asprin manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Asprin
VIEW DETAILS
Buy high quality SORBITOL 70% liquid & powder manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
SORBITOL 70% LIQUID & POWDER
VIEW DETAILS
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
2-Amino-5-chlorobenzophenone

INR 22000

VIEW DETAILS
Buy high quality Ambroxol Hydrochloride Hcl manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
Ambroxol Hydrochloride Hcl
VIEW DETAILS
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Aceclofenac
VIEW DETAILS
Pat Impex is a leading suppliers, exporters, importer, manufacturer of 4-(Piperidin-4-yl)morpholine in small and bulk packing pharmaceutical api intermediates for pharma manufacturing in India, Gujarat, Worldwide.
4-(Piperidin-4-yl)morpholine
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
N,N-Diisopropylethylenediamine
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
TRICHLOROISOCYANURIC ACID - TCCA 90%

INR 230 INR 235
You Save 2.13%

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
BASF Plantacare is a mild, non-ionic, plant-derived surfactant primarily used in personal care products like shampoos, body washes, liquid soaps, and baby care products, offering gentle cleansing, excellent foaming, and good skin compatibility. It is also suitable for use in some household and institutional cleaning products for its detergency and wetting properties.We have regular stock of Basf Plantacare 2000Decyl GlucosideBasf Plantacare 1200Lauryl GlucosideBasf Plantacare 818Coco- GlucosideBasf Plantacare 810Caprylyl/ Capryl Glucoside
View Details
Basf Plantacare Series 2

INR 350

N-Methylmorpholine is the organic compound with the formula O(CH2CH2)2NCH3. It is a colorless liquid. It is a cyclic tertiary amine. It is used as a base catalyst for generation of polyurethanes and other reactions.
View Details
N-Methylmorpholine

INR 430 INR 450
You Save: INR 20 (4.44%)

DIISOPROPYLAMINE used in agro, packaging, food & other industries.
View Details
DIISOPROPYLAMINE

INR 180 INR 200
You Save: INR 20 (10%)

Benzyltriethylammonium chloride is a lipophilic phase-transfer catalyst that can be used in phase-transfer catalysis (PTC) to catalyze polycondensation reactions to form high molecular weight polymers under bi-phasic conditions.
View Details
Benzyltriethylammonium c

INR 365 INR 385
You Save: INR 20 (5.19%)

We are a leading supplier & manufacturer of behentrimonium chloride used in cosmetic and hair care industry.
View Details
Behentrimonium chloride
The primary use of acrylic acid is in the production of acrylic esters and resins, which are used primarily in coatings and adhesives. It is also used in oil treatment chemicals, detergent intermediates, water treatment chemicals, and water absorbent polyacrylic acid polymers.
View Details
Acrylic Acid

INR 72 INR 75
You Save: INR 3 (4%)

Handwash Concentrate in carboys & drums packing, readymade Handwash Concentrate, top quality Handwash Concentrate
View Details
Handwash Concentrate
Best quality White Phenyl Concentrate ready to use compound available at lowest price. Ready to use phenyl Concentrate.
View Details
White Phenyl Concentrate
Poly aluminium chloride liquid 9%, 14%, 17% in tanker load and carboys packing
View Details
Poly aluminium chloride

INR 32

Dodecyltrimethylammonium Bromide, Dodecyltrimethylammonium Bromide is a quaternary ammonium salt useful as paint strippers, foaming stabilizers, and bactericidal lotions.Chemical Propertieswhite to slightly yellow powder
View Details
Dodecyltrimethylammonium

INR 2300 INR 2500
You Save: INR 200 (8%)

Comparative study between 1-propanol, 2-propanol & mecetronium ethyl sulfate (sterillium) hand-rub and chlorhexidine gluconate (microshield) hand-scrub for surgical hand disinfection.Two popular hand disinfectant solutions based on different principles and mechanisms of action were compared as to their ability to eradicate aerobic bacteria and their duration of action. Forty participants were chosen randomly forming two groups. Group A employed the hand scrub method using chlorhexidine (Microshield) and Group B the hand rub method using 1-propanol, 2-propanol and mecetronium ethyl sulfate (Sterillium). Culture swabs were taken from a 25 sq cm area over the palm before, immediately after and two hours after disinfection. The results showed an average of 50,000 colony forming units (CFUs) of bacterial species among the participants before hand disinfection. No bacterial growth was noted immediately after hand disinfection. However, two hours later there were 8 out of 20 (40 percent) positive growth for Group A (30,000 to 70,000 CFUs) and 4 out of 20 (20 percent) positive growth for Group B (40,000 to 70,000 CFUs).Mecetronium ethylsulfate, Mecetronium etilsulfate, Mecetronium ethyl sulfate, Mecetronii etilsulfas [Latin], Mecetronium ethylsulfate [USAN], Etilsulfate de mecetronium [French], Etilsulfato de mecetronio [Spanish], EINECS 221-106-5, Mecetronium ethylsulfate (USAN/INN), Cetyl-ethyl-dimethyl-ammonium ethosulfat, Ethylhexadecyldimethylammonium ethyl sulfate, D04871, 1-Hexadecanaminium, N-ethyl-N,N-dimethyl-, ethyl sulfate, 3006-10-8, 50641-13-9
View Details
Mecetronium ethylsulfate

INR 3100 INR 4000
You Save: INR 900 (22.5%)

GACL - POLY ALUMINIUM CHLORIDE, A top water treatment chemical powder used in various water treatment application, better alternative of ferric and non ferric alum. Used in Municipal water treatmentSewage water treatementPulp & paper industry Decolorisation & Decontamination of dyes in textile industry
View Details
Poly Aluminium Chloride

INR 19 INR 22
You Save: INR 3 (13.64%)

We are premium 4’ CHLOROPROPIOPHENONE supplier, manufacturer and exporter in India. Synonyms: 1-(4-chlorophenyl)-1-propanone
View Details
4'-Chloropropiophenone
Ethyl cyanoacetate is an organic compound that contains a carboxylate ester and a nitrile. It is a colourless liquid with a pleasant odor. This material is useful as a starting material for synthesis due to its variety of functional groups and chemical reactivity.
View Details
Ethyl cyanoacetate
We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
View Details
METHYL CYANOACETATE
Asbestos Powder that we manufacturer is best available quality that anyone can get in India. Our major Product Market is Bharuch, Ankleshwar, Surat, Vadodara, Gujarat , India.. Please Call for best price.We are identified as one of the leading manufacturers, suppliers, wholesalers and exporters of premium quality Asbestos Powder. To provide finest quality, this powder is processed using high quality ingredients that are sourced from certified vendors of the market. We thoroughly check this powder on various parameters like shelf life and precise composition.Features:PurityLonger shelf lifePrecise composition
View Details
ASBESTOS POWDER
Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
View Details
Mastertile 25 Grey

INR 469 INR 475
You Save: INR 6 (1.26%)

2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE, drug intermediates, pharma intermediates available at best rate
View Details
2-CHLOROETHYL MORPHOLINE
Glycerine CP, Glycerine IP, VVF, Adani Wilmar, Godrej available in bulk and small packing from Vadodara, Gujarat, India.
View Details
Glycerine
Methyl isobutyl ketone (MIBK) is the organic compound with the formula (CH3)2CHCH2C(O)CH3. This colourless liquid, a ketone, is used as a solvent for gums, resins, paints, varnishes, lacquers, and nitrocellulose.
View Details
Methyl isobutyl ketone (
GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPIt is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product. CAS No. 38899-05-7
View Details
GLUCOSAMINE SULPHATE SOD
It is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product.
View Details
GLUCOSAMINE HYDROCHLORID
Acesulfame potassium is a calorie-free sweetener that has been used in foods and beverages around the world for 15 years. The ingredient, which is 200 times sweeter than sugar, has been used in numerous foods in the United States since 1988, it is used in such products as candies, baked goods, frozen desserts, beverages, dessert mixes and tabletop sweeteners. Acesulfame potassium, which is also known as acesulfame K, is often used in combination with other low-calorie sweeteners because it enhances the sweet taste of foods and beverages.
View Details
Acesulfame Potassium

INR 825 INR 950
You Save: INR 125 (13.16%)

We leading surplus & non moving, byproduct, waste grade chemicals & pharmaceutical, apis, drugs, solvents stock buyer & seller based at Vadodara, Vapi, Ankleshwar, Mumbai, Pune, Ahmedabad, Gujarat, India since 2009. We have following surplus chemicals in stock at our Gujarat, India location.Acetic Acid Glacial/pharma/commercial - 100 MtSulpuric Acid Commercial - 200 Mt SurplusNitric Acid Commercial - 100 Mt Surplus Acid ChemicalsSoda Ash Tata/nirma - 45 Mt SurplusCitric Acid China - 30 Mt SurplusEthyl Acetate Tanker - 50 Pvc Drums;42 Kg.Toluene Pass 92 % Moisture 0.8%1 , 4 Dioaxan /pure/ Gc 99.78%/kf 0.2% / 35 Drum/Ipa Cbm Gc 99.9% /kf 12% Water White/ph Neutral/ Tanker Load /qnty 16mt/Methanol Distilled / White/d .0.80/ph Neutral/200 DrumMono Ethyl Amine 70%N Propanol Amine 30 Pvc DrumsFormic AcidToluene Recovered No Smell - 99 % Ms DrumPottasium Sulphate 99%+ 5 Mt /off Whitwhite/99%/powder Form/50 Kg PackingOliec AcidMaliec AnhydrideIso Amyl AlcohalSodium Methoxide PowderSodium Methoxide PowderSodium Methoxide PowderTetra Butyl Ammonium Bro.Tetra Butyl Ammonium Bro.2-5 Di Bromo Pyridine4-cyano PyridineIso Nicotinic AcidP0cl3Nicotinic AcidRuthenium 5% AlluminaTri Ethyl AmineZinc DustMalic AcidAmmonium Chloride2, 6 Dimethyl AnilineTitanium ButoxideActivated Carbon Acg GradeCalcium HydroxideCrotonaldehydeAceton RecoverdDenatonium SaccharideActivated CarbonOxalic AcidBromineIsonicotinic Acid (Comm-gr)Sodium SulphatePottasium Carbonate4-fluoro-2-methoxyaniline4-bromo-2, 6-difluorobenzaldehyde2-bromo-5-fluorobenzoic AcidHydroxylamine HydrochlorideBarbituric AcidAmmonium AcetateDiethyl Amino Malonate HclLithium ChloridePhosphorous OxychlorideVinyl AcetateMethane SulfonamideSodium Bis(2-methoxyethoxy)aluminium HydrideDiethyl Oxalate2-ethylbutyric AcidCopper(Ii)sulphateIsopropyl Magnesium Chloride(2m In Thf)Isopropyl Magnesium Chloride(2m In Thf)MorpholineTrifluoromethane Sulfonic AnhydrideTrifluoromethane Sulfonic AnhydrideIron(Iii)nitrate NonahydrateTin PowderSodium Tert-pentoxideIron(Metal) PowderZinc Dust PowderThioureaFormamidine AcetateHydrazine Hydrate-80%3-methyl-2-butanoneAmmonium Bi CarbonateDimethylamine Hydrochloride
View Details
Surplus Chemicals & Phar

INR 2100 INR 2200
You Save: INR 100 (4.55%)

White to Almost Praziquantel white crystalline powder as per IP/BP/EP/USP available.We Pure Chem Pvt Ltd, an ISO 9001:2008 certified APIs and Intermediates manufacturer, supplying Key veterinary APIs like Prazequantel IP/BP/EP/USP for domestic as well as export market.We are now in a field of Veterinary APIs, to offer Key APIs like Prazequantel IP/BP/EP/USP
View Details
Praziquantel

INR 8400 INR 8500
You Save: INR 100 (1.18%)

We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
View Details
Cyanocobalamin Vitamin B
Klucel hydroxypropyl cellulose (HPC) is a nonionic water-soluble cellulose ether with a remarkable combination of properties. It combines organic solvent solubility, thermoplasticity and surface activity with the aqueous thickening and stabilizing properties characteristic of other water-soluble cellulose polymers available from Ashland. Klucel HPC films are flexible without plasticizers and non-tacky at high humidity.
View Details
Klucel hydroxypropylcell
Manufacturer, exporter & suppliers of Lithium Chloride Solution 40% and 50% from Gujarat. Description - Light Yellow colored solution (Lithium Chloride Solution 40%)Specific Gravity at 25C g/cm3 260 – 1.262Assay (by Titration, %) Wt. % 40.00 Min.Alkalinity as LiOH (%) Wt. % 0.1 Max.Inhibitor (Na2CrO4) Wt. % 0.6 + 0.05Calcium (Ca, %) Wt. % 0.006 Max.Magnesium (Mg, %) Wt. % 0.0004 MaxSulphate (SO4, %) Wt. % 0.002 Max.
View Details
Lithium Chloride Solutio
Composite acrylic polymer based cementitious crack resistant flexible waterproofing coating, MoistureZero is formulated specially for use in combination with all kinds of cement blends.It is to be used in cementitious slurries as a polymerizing agent and modifier to enhance durability of slurry against moisture ingress along with resistance to hair line cracks.Better performance as compared to similar products like Tapecrete P151 or others.Sunken areasWater bodiesTerraces where roof garden not presentCoverage:It depends on the substrate type (smooth or rough) and application skills.On Smooth Concrete 1Kg / 2 Coats / 15-20 Sq. FtOn Smooth Concrete 1Kg /3 Coats with Fibre layer / 8-12 Sq. Ft
View Details
BUILDSMART BS MoistureZe

INR 235 INR 252
You Save: INR 17 (6.75%)

High quality ACITRETIN pharma neutraceuticals available with us. We are a self importer of this products in 1 kg & 5 kgs packing. Available in stock
View Details
ACITRETIN
Foremost 310 Crystalline Monohydrate available for pharmaceutical industry, pharma excipients, food and cosmetic industry. Crystalline Monohydrate Foremost 310 is a brand name of KERRY Ingredient USA. We are a suppliers and importers of Kerry Ingredients USA.
View Details
Crystalline Monohydrate
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
View Details
Caustic Soda Flakes

INR 1599

IUPAC Name: 2-Isocyanato-1,3-dimethylbenzene Empirical Formula: C9H9NO Molecular Weight: 147.1739 Freely Rotating Bonds: 1 Polar Surface Area: 29.43 Å2 Index of Refraction: 1.515 Molar Refractivity: 45 cm3 Molar Volume: 149 cm3 Polarizability: 17.84× 10-24 cm3 Surface Tension: 33 dyne/cm Density: 0.98 g/cm3 Flash Point: 74.5 °C Enthalpy of Vaporization: 44.19 kJ/mol Boiling Point: 205.6 °C at 760 mmHg Vapour Pressure: 0.247 mmHg at 25°C
View Details
2, 6-Dimethylphenyl isoc
Ichthammol is also called Ichthammolum. Chemically called Ammonium Ichthosulfonate or Ammonium Bituminosulfonate. Ichthammol is the ammonium salt of dark sulfonated shale oil. Ammonium Bituminosulfonate is used successfully as active pharmaceutical ingredient(API) of natural origin for more than 10 decades for the treatment of skin diseases.Technically, Ichthammol is a mixture of many different compounds. Not only singe substance.Chemically, Ammonium Bituminosulfonate is a sulfonated shale oil which is incompatible with acids, alkali carbonates or hydrates and alkaloidal salts. Ichthammol is a thick reddish brown liquid, with a bituminous odor and taste. Ammonium Bituminosulfonate is soluble in water and miscible with glycerol. However, Ichthammol is almost insoluble in strong alcohol or concentrated ether. Ammonium Ichthosulfonate contains a large percentage of organically combined sulfur.
View Details
Ammonium Ichthosulphonat

INR 2920 INR 2950
You Save: INR 30 (1.02%)

It is used as a flame retardant in ABS, other plastics and yarn, a flocculant in the production of titanium dioxide and in the production of glass, paint and adhesives. It is also used as an ion-exchange resin for a number if cations in acidic solution including Na+ and as a polymerization and oxidation catalyst.
View Details
Antimony Trioxide Powder
The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
View Details
Zeolite 4A

INR 22 INR 25
You Save: INR 3 (12%)

Lithium Carbonate Manufacturer Lithium carbonate is an inorganic compound, the lithium salt of carbonate with the formula Li2CO3This white salt is widely used in the processing of metal oxides.For the treatment of bipolar disorder, it is on the World Health Organization's List of Essential Medicines, the most important medications needed in a basic health system.Other names : Dilithium carbonate, Carbolith, Cibalith-S, Duralith, Eskalith, Lithane, Lithizine, Lithobid, Lithonate, Lithotabs Priadel, ZabuyeliteCAS Registry Number: 554-13-2Chemical formula : Li2CO3
View Details
Lithium Carbonate
We are a manufacturer & supplier of Zinc Sulphate Heptahydrate zn 21% in India.As Mordant in Calico-Printing; Preserving Wood & Skins; with Hypcochlorite for Bleaching Paper, Manufacturing Lithopone & other Zinc Salts; Clarifying Glue; Electrodepositing Zn; also as reagent in analytical Chemistry.
View Details
Zinc Sulphate Heptahydra

INR 34 INR 42
You Save: INR 8 (19.05%)

Pat Impex is a leading importer and supplier of Polyvinyl Chloride PVC Resin. We are a importer of Polyvinyl Chloride PVC Resin from Thailand, Gulf Countries, LG, Hanwha, ocean, georgia, ineos in India.
View Details
Polyvinyl Chloride PVC R
Buy high quality Vardenafil Hcl Trihydrate manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, textile, chemical compound for pharmaceutical and chemicals process industry available at best price.
View Details
Vardenafil Hcl Trihydrat
Buy high quality Povidone Iodine manufacturer, supplier, importer, dealer, distributor, trader, exporter that is used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, textile, chemical compound for pharmaceutical and chemicals process industry available at best price.
View Details
Povidone Iodine
Buy high quality polyelectrolyte (Grade - Anionic, Cationic, Non Ionic) manufacturer, supplier, exporter, importer, dealer based at Vadodara, Gujarat, India for waste water treatment, etp treatment, water purification, oil recovery, color removal, paper making, mineral processing. It has anionic emulsions and dry polyacrylamides which can be used wherever liquid/solids separation is needed in industrial effluent treatment applications.
View Details
Polyelectrolyte
Leading exporter, manufacturer, supplier, dealer & distributor of Hydrochloric Acid - HCL chemicals in Tanker Load, Carboys packing and export packing from Vadodara, Gujarat, India. Hydrochloric Acid - 32-33% Hydrochloric Acid HCL - Surplus & By product grade also available.
View Details
HYDROCHLORIC ACID
Peracetic acid is an environmentally safe and versatile anti-microbial agent and a powerful antioxidant. It emits oxygen at lower temperatures than other bleaching agents. It is effective against micro-organisms and is not deactivated by catalase and peroxidase, the enzymes that break down hydrogen peroxide. It is widely used in food applications.Dairies, wineries, breweries and beverage plants,Meat and poultry processing and packaging,Milk and dairy products processing and packaging plants,Seafood and produce processing and packaging plants,Food processing and packaging plants,Egg processing and packaging equipment surfaces,Eating establishments
View Details
Peracetic acid
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
View Details
Isopropyl Alcohol
Best high quality Chlorhexidine Acetate BP/EP/USP made from fresh and quality raw material. We are one of the leading manufacturer & exporter from India. With the strong knowledge of this domain, our chemists support our firm to offer Chlorhexidine Acetate. The provided chemical is used for treating fungus and bacterial infection, this solution is also tested on set qualitative parameters to ensure their effectiveness. Furthermore, clients can avail this Chlorhexidine Acetate from us in various packaging options at economical prices.Features:Excellent Antiseptic High effectivenessZero side effectsLonger shelf life
View Details
Chlorhexidine Acetate BP
Buy high quality Chlorhexidine Gluconate 20% manufacturer, supplier, importer, dealer, distributor, trader, exporter from Vadodara, Gujarat, India & used in pharma intermediate, catalyst, bulk drugs, apis, pharma chemicals, active pharmaceutical ingredients, additives, contract manufacturing, chemical compound for pharmaceutical and chemicals process industry available at best price.
View Details
Chlorhexidine Gluconate
Buy high quality Asprin manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Asprin
Buy high quality SORBITOL 70% liquid & powder manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
SORBITOL 70% LIQUID & PO
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
View Details
2-Amino-5-chlorobenzophe

INR 22000

Buy high quality Ambroxol Hydrochloride Hcl manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
View Details
Ambroxol Hydrochloride H
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Aceclofenac
Pat Impex is a leading suppliers, exporters, importer, manufacturer of 4-(Piperidin-4-yl)morpholine in small and bulk packing pharmaceutical api intermediates for pharma manufacturing in India, Gujarat, Worldwide.
View Details
4-(Piperidin-4-yl)morpho
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
View Details
N,N-Diisopropylethylened
Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
View Details
TRICHLOROISOCYANURIC ACI

INR 230 INR 235
You Save: INR 5 (2.13%)

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share