OMINDUSTRIALSERVICES Manufacturer
Vadodara patimpex@gmail.com
917779008081
Chat with us  

Chat with us on WhatsApp

×
Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

OMINDUSTRIALSERVICES 5849488be120430a1cc90e72 Manufacturer https://www.patimpex.in
Home
manufacturer
Quote
Menu
Home Products india

Our Manufacturer

india
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
Lidocaine Base HCL IP BP USP
VIEW DETAILS
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
Lidocaine Base HCL IP BP USP
VIEW DETAILS
Emerged as a reputed Material & Service provider of the industry, we are engaged in rendering qualitative Various Floor Coating Material and Services.Epoxy FlooringPU FlooringUcrate FlooringMastic FlooringHeavy Screed Flooring3D FlooringMettalic FlooringDesigner FlooringMicro Chipping FlooringPolyUratha FlooringConductive / Anti Static FlooringHybrid Flooring
Floor and Wall Coating

INR 57 INR 58
You Save 1.72%

VIEW DETAILS
2-Chloro-5-Nitrobenzoic Acid raw materials, powder manufacturer of nitrobenzoic acid
2-Chloro-5-Nitrobenzoic Acid

INR 2480 INR 2500
You Save 0.8%

VIEW DETAILS
Offering high quality Sodium Selenite Pentahydrate BP, pharma grade Sodium Selenite Pentahydrate BP, feed industry chemicals,medicinal grade Sodium Selenite Pentahydrate BP
Sodium Selenite Pentahydrate BP

INR 1660 INR 1662
You Save 0.12%

VIEW DETAILS
TUNGSTATE CHEMICALS MANUFACTURER, TUNGSTATE PIGMENTS, TUNGSTATE SODIUM CHEMICALS, Tungsten Carbide PowderTungsten PowderPotassium TungstateSodium Tungstate HydrateTungstic AcidPhosphotungstic Acid HydrateSodium MetatungstateTungsten TrioxideSilicotungstic AcidTungsten DisulphideAmmonium Para TungstateAmmonium Meta TungstateCadmium tungstateCobalt TungstateCesium TungstateMagnesium TungstateBismuth Tungsten OxideManganese TungstateBarium Tungstate
TUNGSTATE CHEMICALS MANUFACTURER

INR 335 INR 390
You Save 14.1%

VIEW DETAILS
Ethyl chemicals, acetate chemicals, bromide chemicalsEthyl acetateEthyl BromideEthyl cellosolveEthyl CelluloseEthyl Chlorideethyl chloroacetateEthyl Cyano Acetate (ECA)Ethyl Cyano Acrylate
ETHYL CHEMICALS

INR 253 INR 255
You Save 0.78%

VIEW DETAILS
META CHLOROANILINE 3-CHLOROANILINE, pharma chloroaniline intermediates, chloroaniline chemicals manufacturer
META CHLOROANILINE 3-CHLOROANILINE

INR 1248 INR 1250
You Save 0.16%

VIEW DETAILS
medicinal CHROMIUM PICOLINATE USP, pharma grade CHROMIUM PICOLINATE USP, high quality CHROMIUM PICOLINATE USP, Chromium picolinate has been used in alternative medicine to treat chromium deficiency, as an aid to controlling blood sugar in people with diabetes or prediabetes, to lower cholesterol, and as a weight-loss supplement.
CHROMIUM PICOLINATE USP

INR 2278 INR 2280
You Save 0.09%

VIEW DETAILS
pharma grade EDETATE DISODIUM DIHYDRATE IP BP USP, animal feed EDETATE DISODIUM DIHYDRATE IP BP, feed EDETATE DISODIUM DIHYDRATE USP, cosmetic EDETATE DISODIUM DIHYDRATE,
EDETATE DISODIUM DIHYDRATE IP BP USP

INR 188 INR 190
You Save 1.05%

VIEW DETAILS
CITRIC ACID ANHYDROUS IP BP USP, pharma grade CITRIC ACID ANHYDROUS IP BP USP, food grade CITRIC ACID ANHYDROUS IP BP USP, fine chemicals CITRIC ACID ANHYDROUS IP BP USP,
CITRIC ACID ANHYDROUS IP BP USP

INR 64 INR 66
You Save 3.03%

VIEW DETAILS
1,6-Hexanediol Diacrylate,Allyl Methacrylate,Ethylene Glycol Dimethylacrylate,Glycidyl Methacrylate,Trimethylolpropane Triacrylate,Trimethylolpropane Trimethacrylate, Crosslinkers Chemicals
Crosslinkers Chemicals

INR 200 INR 220
You Save 9.09%

VIEW DETAILS
MONOMETHYLAMINE, METHANAMINE imported ready stock available,
MONOMETHYLAMINE (METHANAMINE)

INR 108 INR 110
You Save 1.82%

VIEW DETAILS
Importer, contract manufacturer & supplier of aroma aromatic chemicals, flavor & fragrance chemicals in Vadodara, Gujarat, India. Acetal E (Verotyl)AcetoinAganile (Peonile)Aldehyde C11 (Undecylenic Aldehyde)Allyl CaproateAllyl Cyclo Hexyl PropionateAllyl HaptoateAlpha DamasconeAlpha Pinene 95%Ambergris Ketone (Iso E Super)Ambermor Dl (Ambrox Dl)Ambermor Flakes (Ambroxan)Ambermor Ketal (Amber Ketal)AmbretolideAmbrocenide PureAmyris OilAndreneAnethole 99%Angelica Seed OilAnisyl AcetoneAquamor (Calone)Armoise OilAtralone (Evernyl)AurantilolBalsam PeruBenzophenoneBergamot OilBeta DamasconeBeta PineneBezyl SalicylateBuchu Leaf OilButyl Butyryl LactacteCaraway OilCaryophyllene AcetateCaryophyllene OxideCashmeranCat KetoneCedarwood Oil TexasCedrol CrystalsCedryl Acetate CrystalsCedryl Acetate LiquidCedryl Methyl EtherCelestolideChamomile Oil Blue / RomanCinnamic AcidCinnamyl AcetateCinnamyl FormateCis - 3 - Hexenyl 2 Methyl ButyrateCis - 3 - Hexenyl AcetateCis - 3 - Hexenyl BenzoateCis - 3 - Hexenyl ButyrateCis - 3 - Hexenyl CaproateCis - 3 - Hexenyl Iso ButyrateCis - 3 - Hexenyl Iso ValerateCis - 3 - Hexenyl Phenylâ Â AcetateCis - 3 - Hexenyl PropionateCis - 3 - Hexenyl TiglateCis 6 NonenalCis 6 NonenolCis JasmoneCitralCitronellolCitronellyl AcetateCitronellyl ButyrateCitronellyl CaproateCitronellyl FormateCitronellyl Iso ButyrateCitronellyl Iso ValerateCitronellyl PropionateCitronellyl TiglateClary Sage OilClove Leaf OilClove Oil PgClove Oil Rectified 85%Clove TerpenesCoriander Seed OilCuminic AldehydeCyclo Hexyl SalicylateD LimoneneD.m.b.c.D.m.b.c.a.D.m.b.c.b.DamascenoneDelta DamasconeDelta DecalactoneDelta DodecalactoneDelta HexalactoneDelta NonalactoneDelta OctalactoneDelta TetradecalactoneDelta UndecalactoneDi Hydro Ionone BetaDi Hydro JasmoneDi Hydro TerpeniolDi Hydro Terpinyl AcetateDi Methyl Phenyl EthylDi MetolDi Phenyl MethaneDiacetylDifurfuryl DisulphideDihydro Myrcenyl AcetateDmo AcetateDynamor (Dynascone Pure)Elemi OilEthyl 2 Methyl ButyrateEthyl ButyrateEthyl CinnamateEthyl MaltolEthyl Phenyl AcetateEthyl SafranateEthyl VanillinEthylene Brassylate (Musk - T)Eucalyptol Pure (99%)EugenolEugenyl AcetateFdl - 40Fenchyl AcetateFenchyl Alcohol (Fenchol)FructoneFuranone (Furaneol)Furfuryl AlcoholFurfuryl MercaptanGalaxolide 50% DepGalaxolide 50% IpmGalaxolide PureGalbanum OilGamma DecalactoneGamma DodecalactoneGamma HeptalactoneGamma HexalactoneGamma NonalactoneGamma OctalactoneGamma Undecalactone (C-14)Gamma ValerolactoneGarlic OilGeraniol 60Geraniol 98Geranium OilGeranyl Acetateâ (Min 98% / 2 Peak)Geranyl ButyrateGeranyl FormateGeranyl Iso ButyrateGeranyl Iso ValerateGeranyl PropionateGeranyl TiglateGreen Leaf (Trans 3 Hexenol)Guaiacwood OilGuaiyl AcetateGurjun Balsam Oil Dark / LightHeliogan (Helional)HelionalHexyl AcetateHexyl ButyrateHexyl Iso ButyrateHexyl SalicylateHydroxyambranIso Amyl AcetateIso Amyl ButyrateIso Bornyl AcetateIso Butyric AcidIso Cyclo CitralIso Valeric AcidIso Amyl PropionateIso Amyl SalicylateJasmorangeKaramorKovyral (Lyral)L BacdanolL Carvone 99%Lavender AbsoluteLavender OilLavendin Abrillis OilLavendin AbsoluteLavendin Grosso OilLemon OilLemon Oil (4% Citral)LinaloolLinalool OxideLinalyl AcetateLinlan Alcohol (Majantol)M.c.k. 80% (Methyl Cedryl Ketone)MaltolMandarin Oil GreenMandarin Oil RedManzanateMaple LactoneMelomorMenthyl LactateMethionalMethoxy Phenal (Canthoxal)Methyl Amyl KetoneMethyl CinnamateMethyl Dihydro Jasmonate (Hc30 / Hc70)Methyl Dihydro Jasmonate (Hedione)Methyl PamplemousseMethyl Phenyl AcetateMilk LactoneMuscemore (Muscenone)MusconeMuscosandrol (Ebanol)Musk AmbretteMusk C - 14Musk KetoneMusk XylolMyrac Aldehyde (Myral)Myrcene 80N Butyric AcidN HexanolNerylacetateNoot Ketone CrystalsNopyl AcetateNutmeg OilOakmoss AbsoluteOcimeneOctyl AcetateOnion OilOrange CarbonylOrange OilOrange Oil BitterPadmaPara Cresyl AcetatePatchouli OilPatchouli Oil (Rco)Patchouli Oil (Standard)Patchouli Oil Iron FreePetit Grain OilPhenyl Ethyl AcetatePhenyl Ethyl BenzoatePhenyl Ethyl ButyratePhenyl Ethyl FormatePhenyl Ethyl Iso ButyratePhenyl Ethyl TiglatePhenyl HexanolPoivrol (Mahagonate)Precyclemone BPropenyl GuaetholPropionic AcidPyranolRaspberry KetoneResinoid BenzoinResorcinol Dimethyl EtherRhodinol (Ex Geranium)Rhodinol (Synthetic)Rhodinyl AcetateRomoxyde (Cedroxyde)RosalvaRose Oxide 70:30 (Inactive)Rose Oxide 90:10 (High Cis)Rose Petal Acetate (Roseate)Rosemary OilSage OilSandal BoosterSandelorSandenol (Icch)SclareolSclareolideStrawberryiffStyrax OilSulfurolSulfuryl AcetateTerpenyl AcetateTerpinen-4-olTetra Hydro Geraniol (Dmo)Tetrahydro LinaloolThiomenthoneTonalideTrans 3 Hexenyl AcetateTrans 3 Hexenyl BenzoateTrans-2-hexenalTrans-2-hexenolTrigustral (Triplal)Triplal (Hivertal, Ligustral)TropathianeValenceneVeratraldehydeVetiver Oil (Haiti)Vetiveryl Acetate (Eco)Vetiveryl Acetate (Ex Haiti)Whisky LactoneWoodamberYlang Oil ExtraYlang Oil IiiZingerone
AROMATIC FLAVOR & FRAGRANCE CHEMICALS

INR 369 INR 380
You Save 2.89%

VIEW DETAILS
Importer & supplier of aromatic intermediates, aroma chemicals, flavor chemicals, fragrance chemicals in India.2-Acetyl Pyrazine2 Methyl Butyric Acid2 Methyl Undecanal2 Pentyl Cyclo Pentanone (Delphone)2-3 Dimethyl Pyrazine2-3-5 Trimethyl Pyrazine2-3-5-6 - Tetra Methyl Pyrazine2-acetyl Furan2-ethyl Pyrazine2-ethyl-3-5-dimethyl Pyrazine2-iso Propyl- 4-methyl Thiazole2-isobutyl Methoxy Pyrazine2-methoxy-3- Methyl Pyrazine2-methoxy-4-vinylphenol2-methyl Pyrazine2-methyl Thio-(3 Or 5)-methyl Pyrazine2-sec Butty-3-methoxy Pyrazine3-mercaptohexanol4 Acetoxy Furanone4 Vinylguaiacol4-methyl-5-Vinayl Thiazole4-methyl-5-vinylthiazole5-methyl Furfural6-methylcoumarin
AROMATIC INTERMEDIATES

INR 248 INR 250
You Save 0.8%

VIEW DETAILS
Manufacturer exporter & supplier of carbonate & bicarbonate IP BP USP pharma grade chemicals.Pharma comply carbonate chemicals, Pharma grade bicarbonate chemicals,Calcium Carbonate IP/BP/USP,Sodium Carbonate Anhydrous IP/BP/USP NF,Sodium Carbonate Monohydrate IP/BP/USP NF,Potassium Carbonate,Zinc Carbonate USP,Sodium Bicarbonate IP/BP/USP,
CARBONATES & BICARBONATES IP BP USP PH

INR 78 INR 80
You Save 2.5%

VIEW DETAILS
This medication is an iron supplement used to treat or prevent low blood levels of iron (such as those caused by anemia or pregnancy). Iron is an important mineral that the body needs to produce red blood cells and keep you in good health.
FERROUS SULPHATE DRIED IP BP USP

INR 26 INR 28
You Save 7.14%

VIEW DETAILS
Para tertiary butylphenol formaldehyde resin also known as p-tert-butylphenol-formaldehyde resin (PTBP-FR) or 4-(1,1-dimethylethyl) phenol (PTBP Formaldehyde) is a phenol-formaldehyde resin found in commercial adhesives, and in particular in adhesives used to bond leather and rubber.
Para tertiary butylphenol

INR 230 INR 250
You Save 8%

VIEW DETAILS
Propyl acetate, also known as propyl ethanoate, is a chemical compound used as a solvent and an example of an ester. This clear, colorless liquid is known by its characteristic odor of pears. Due to this fact, it is commonly used in fragrances and as a flavor additive.
N PROPYL ACETATE

INR 123

VIEW DETAILS
N-Bromosuccinimide is a chemical reagent used in electrophilic additions and radical substitution reactions in synthetic organic chemistry. In Wohl-Ziegler reaction, it is involved in allylic and benzylic bromination reaction. It is also used in the alfa-bromination of carbonyl derivatives.
N-Bromosuccinimide

INR 2800 INR 2832
You Save 1.13%

VIEW DETAILS
Offering high quality hand sanitizers, 5 liters packing, IPA - Isopropyl Alcohol & Ethanol - Ethyl Alcohol. Contact for bulk and small packing price.
5 Liters Hand Sanitizer SANI 711

INR 502 INR 520
You Save 3.46%

VIEW DETAILS
In addition to carbonated diet drinks, saccharin is used to sweeten low-calorie candies, jams, jellies, and cookies. It's also used in many medicines. Saccharin can be used similarly to table sugar to sprinkle onto food, such as cereal or fruit, or used as a sugar substitute in coffee or when baking.
SODIUM SACCHARIN
VIEW DETAILS
TERPINYL BUTYRATE available in stock
TERPINYL BUTYRATE

INR 350

VIEW DETAILS
It is used commercially as a component in perfumes and in flavor production for the food industry. It is usually produced by hydroformylation of heptene and the dehydrogenation of 1-octanol. Octanal can also be referred to as caprylic aldehyde or C8 aldehyde.
Aldehyde C-8 Aromatic Chemical

INR 1600

VIEW DETAILS
Agrochemical Category:Fungicide, HerbicideIndustry Uses:Adhesives and sealant chemicals Corrosion inhibitors and anti-scaling agents
Disodium Ethylenebis Dithiocarbamate
VIEW DETAILS
Acid slurry manufacturer in drums & carboys, vadodara
Acid slurry

INR 85

VIEW DETAILS
p-Divinylbenzene(DVB) is a cross-linking agent, which is used in a variety of polymeric processes such as copolymerization of styrene to improve the thermo-mechanical properties of the composite.
p-Divinylbenzene(DVB)
VIEW DETAILS
High quality cosmetic chemicals Tetrasodium glutamate diacetate available in stock
Tetrasodium glutamate diacetate

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
Offering high quality paracetamol powder, paracetamol BP USP PH EUR grade
Paracetamol Powder
VIEW DETAILS
We are dealing in all types of polyelectrolyte Anionic, Cationic, Nonionic. They are thus often used as thickeners, emulsifiers, conditioners, clarifying agents, and even drag reducers. They are used in water treatment and for oil recovery.
Polyelectrolyte polyacrylamide (Anioni

INR 143 INR 145
You Save 1.38%

VIEW DETAILS
Manufacturer, exporters & suppliers of quaternary ammonium & phosphonium compounds in India. Alkyl Trimethyl Ammonium BromideBenzalkonium Chloride 50% & 80%Benzalkonium Chloride PowderBenzyl Tributyl Ammonium ChlorideBenzyl Triethyl Ammonium Chloride 50%Benzyl Trimethyl Ammonium BromideBenzyl Trimethyl Ammonium ChlorideBenzyl Trimethyl Ammonium Dichloro IodideBenzyl Triphenyl Phosphonium ChlorideButyl Triethyl Ammonium BromideCetalkonium BromideCetalkonium ChlorideCetrimide 40% Strong SolutionCetrimide Ip/bp/usp/epCetrimide Powder BP / IPCetyl Dimethyl Amine Oxide 30%Cetyl Dimethyl Benzyl Ammonium BromideCetyl Dimethyl Benzyl Ammonium ChlorideCetyl Dimethyl Benzyl Ammonium ChlorideCetyl Pyridine Chloride CpcCetyl Pyridinium ChlorideCetyl Trimethyl Ammonium BromideCetyl Trimethyl Ammonium Bromide PowderCetyl Trimethyl Ammonium ChlorideCetyl Trimethyl Ammonium Chloride 30%Cetyl Trimethyl Ammonium Chloride 50%Cetyl Trimethyl Ammonium Chloride PowderCetyl Trimethyl Ammonium Ptoluene SulfonateCetyl Trimethyl Ammonium TosylateCetylpyridinium ChlorideChlorhexidine Acetate BP/EP/USPChlorhexidine BaseChlorhexidine Gluconate 20% Solution BP/EP/USPChlorhexidine Hydrochloride BP/EP/USPDidecyl Dimethyl Ammonium Bromide 65%Didecyl Dimethyl Ammonium Chloride 80%Dodecyl Trimethyl Ammonium Bromide PowderDodecyl Trimethyl Ammonium ChlorideDodecyl Trimethyl Ammonium Chloride PowderEthyl Hexadecyl Dimethyl Ammonium BromideEthyl Triphenyl Phosphonium BromideEthyl Triphenyl Phosphonium ChlorideHexadectyl Trimethyl Ammonium ChlorideHexadecyl Trimethyl Ammonium BromideLauryl Dimethyl Amine Oxide 30%Lauryl Trimethyl Ammonium ChlorideMethyl Paraben BPMethyl Tributyl Ammonium BromideMethyl Tributyl Ammonium ChlorideMethyl Tributyl Ammonium ChlorideMethyl Tricapryl Ammonium ChlorideMethyl Trimethyl Ammonium ChlorideMethyl Trioctyl Ammonium ChlorideMethyl Triphenyl Phosphonium BromideMethyl Triphenyl Phosphonium ChlorideMyristyl Dimethyl Amine Oxide 30%Myristyl Dimethyl Benzyl Ammonium ChlorideMyristyl Trimethyl Ammonium BromideMyristyl Trimethyl Ammonium Bromide PowderMyristyl Trimethyl Ammonium Chloride PowderPhenyl Trimethyl Ammonium ChloridePhenyl Trimethyl Ammonium TribromidePovidone Iodine 10% Solution USPPovidone Iodine Powder USPPropyl Paraben BPSodium Methyl Paraben BPSodium Propyl Paraben BPStrong Cetrimide 40% Solution w/v BPTertiary Butyl HydroquinoneTetra Butyl Ammonium BromideTetra Butyl Ammonium ChlorideTetra Butyl Ammonium Fluoride 1m In ThfTetra Butyl Ammonium Fluoride TrihydrateTetra Butyl Ammonium Hydrogen SulphateTetra Butyl Ammonium HydroxideTetra Butyl Ammonium IodideTetra Butyl Ammonium PerchlorateTetra Butyl Ammonium Ptoluene SulfonateTetra Butyl Ammonium TosylateTetra Ethyl Ammonium BromideTetra Ethyl Ammonium IodideTetra Ethyl Ammonium Ptoluene SulfonateTetra Ethyl Ammonium TosylateTetra Methyl Ammonium BromideTetra Methyl Ammonium ChlorideTetra Methyl Ammonium ChlorideTetra Methyl Ammonium HydroxideTetra Methyl Ammonium IodideTetra Octyl Ammonium BromideTetra Propyl Ammonium BromideTetra Propyl Ammonium Bromide (50% Aqueous Solution)Tetra Propyl Ammonium IodideTetradecyl Trimethyl Ammonium BromideTributyl Ammonium Chloride
EUROPE & AFRICA QUATERNARY COMPOUNDS

INR 425 INR 445
You Save 4.49%

VIEW DETAILS
HEDP is an organophosphoric acid corrosion inhibitor. It can chelate with Fe, Cu, and Zn ions to form stable chelating compounds.It can dissolve the oxidized materials on these metals’ surfaces. HEDP shows excellent scale and corrosion inhibition effects under temperature 250℃. HEDP has good chemical stability under high pH value, hard to be hydrolyzed, and hard to be decomposed under ordinary light and heat conditions. Its acid/alkali and chlorine oxidation tolerance are better than that of other organophosphoric acids (salt). HEDP can react with metal ions in water system to form hexa-element chelating complex, with calcium ion in particular. Therefore, HEDP has good antiscale and visible threshold effects. When built together with other water treatment chemicals, it shows good synergistic effects.
1-Hydroxy Ethylidene-1,1-Diphosphonic

INR 92 INR 95
You Save 3.16%

VIEW DETAILS
Available in stock, quaternary ammonium bromide compoundsDidecyl Dimethyl Ammonium Bromide 65%Myristyl Trimethyl Ammonium Bromide PowderTetra Ethyl Ammonium BromideDodecyl Trimethyl Ammonium Bromide PowderTetra Butyl Ammonium BromideAlkyl Trimethyl Ammonium BromideEthyl Hexadecyl Dimethyl Ammonium BromideTetra Propyl Ammonium BromideCetyl Trimethyl Ammonium Bromide Powder
QUATERNARY AMMONIUM BROMIDE

INR 260 INR 280
You Save 7.14%

VIEW DETAILS
Benzyltriethylammonium chloride is a lipophilic phase-transfer catalyst that can be used in phase-transfer catalysis (PTC) to catalyze polycondensation reactions to form high molecular weight polymers under bi-phasic conditions.
Benzyltriethylammonium chloride

INR 365 INR 385
You Save 5.19%

VIEW DETAILS
Best quality White Phenyl Concentrate ready to use compound available at lowest price. Ready to use phenyl Concentrate.
White Phenyl Concentrate
VIEW DETAILS
Ethylene glycol distearate (or EthyleneGlycol Distearate - EGDS) is a product commonly used in cosmetic formulations, as an agent providing a certain pearlscence and / or thickening and / or stabilizing agent. ... The crystals may preferably be included in a fluid concentrated ingredient to be formulated.
Ethylene glycol distearate

INR 86 INR 87
You Save 1.15%

VIEW DETAILS
We offer high and fine quality Crude Glycerine Liquid to our most reliable customers which are situated all round the nation.
Crude Glycerine Liquid

INR 34 INR 37
You Save 8.11%

VIEW DETAILS
Offer to sell high quality Lithium Carbonate chemicals
Lithium Carbonate
VIEW DETAILS
BEST PRICE FOR POLYSORBATE 20, PHARMACEUTICAL EXCIPIENTS, CREAM MANUFACTURING
POLYSORBATE 20
VIEW DETAILS
Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
Foamaster Series Additives

INR 530 INR 550
You Save 3.64%

VIEW DETAILS
Desalination, Disinfection, Foam Control, Metals Removal, Nutrient Removal 5-Chloro-2-Methyl-4-Isothiazolin Ones,2-Methyl-4-Isothiazolin Ones
CIT MIT Based Biocide
VIEW DETAILS
We have successfully been engaged in providing excellent quality Ammonium Acetate. At our well-advanced labs, the offered acetate is processed under suitable conditions with the use of best grade chemicals by our dexterous team of professionals. The provided chemical is effective to be used as an important food additive. Also, it is used with acetic acid for the preparation of buffer solution. Additionally, our clients can purchase this Ammonium Acetate at reasonable prices from us.
AMMONIUM ACETATE

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
We are instrumental in formulating and processing a wide range of high quality Potassium mono persulfate. Our organization is counted amongst the reputed names of the market engaged in processing, trading and wholesaling different types of chemicals that are formulated using quality ingredients. These chemicals are highly effective and accurately proportion of ingredients is added to to the composition, so as to add longer shelf life and longer usability. Clients across different industries avail our products. We can offer these in different specifications like grades, volatility and dilutions. Minimum Order Quantity 25 KgForm PowderSize/Dimension CustomizePackaging Size 25 kgs HDPE DRUMGrade High leavel disinfectantBrand Usage/Application High level disinfectantPurity Pure
Potassium mono persulfate

INR 982 INR 1100
You Save 10.73%

VIEW DETAILS
Ethyl cyanoacetate is an organic compound that contains a carboxylate ester and a nitrile. It is a colourless liquid with a pleasant odor. This material is useful as a starting material for synthesis due to its variety of functional groups and chemical reactivity.
Ethyl cyanoacetate
VIEW DETAILS
We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
METHYL CYANOACETATE
VIEW DETAILS
Carbopol 940 polymerCarbopol 940 polymer is a white powder, crosslinked polyacrylic acid polymer. It is an extremely efficient rheology modifier capable of providing high viscosity and forms sparkling clear gels or hydro-alcoholic gels and creams. Its short flow, non-drip properties are ideal for applications such as clear gels, hydroalcholic gels, and creams.Features/BenefitsCompatible with other materials used in styling gelsHigh viscosity builder and stabilizerProvides clarity and a high suspending ability in hair gelsProvides high clarityShort flow rheology characteristics
Carbopol 940 polymer
VIEW DETAILS
Glycereth Cocoates used in Bath and shower products Hair care Men's grooming products Skin care
Glycereth Cocoates
VIEW DETAILS
Petroleum jelly, petrolatum, white petrolatum or soft paraffin, CAS number , is a semi-solid mixture of hydrocarbons (with carbon numbers mainly higher than originally promoted as a topical ointment for its healing properties.
White Petroleum Jelly
VIEW DETAILS
We are one of the leading 3-Ethynylaniline supplier, manufacturer and exporter in India. Our this product is developed in an automatic manufacturing plant using the best quality raw materials. Further, this product is made as per international norms and standards and tested on various quality parameters. Our products are highly appreciated and demanded in various business segments due to their best quality and reliability. We offer this chemical in various packing options to our customers as per their requirement at best competitive prices.
3-Ethynylaniline
VIEW DETAILS
Methanesulfonic anhydride Trifluoro Methane Sulfonic AnhydrideAPPEARANCE: colorless to light yellow liquid, strong corrosive, strong hygroscopic, strong volatile.USAGE: widely used as intermediate in medicine and chemical industry.
Methanesulfonic anhydride
VIEW DETAILS
Offering high quality Ursodeoxycholic acid, contract manufacturer in India. Available in small and bulk packing.Ursodeoxycholic acid (UDCA), also known as ursodiol is one of the secondary bile acids, which are metabolic byproducts of intestinal bacteria.
Ursodeoxycholic Acid
VIEW DETAILS
Salbutamol Sulphate is used to treat wheezing and shortness of breath caused by breathing problems (such as asthma, chronic obstructive pulmonary disease). Albuterol - Salbutamol Sulphate belongs to a class of drugs known as bronchodilators. It works in the airways by opening breathing passages and relaxing muscles. Controlling symptoms of breathing problems can decrease time lost from work or school. We are a leading manufacturer and supplier of Salbutamol Sulphate.
Salbutamol Sulphate

INR 6750 INR 7000
You Save 3.57%

VIEW DETAILS
Chlorpheniramine Maleate suppliers, Manufacturer imported available in stock
Chlorpheniramine Maleate
VIEW DETAILS
Activated Carbon is a porus form of carbon which is manufactured from various carbonaceous raw materials like Pine wood, Coconut shell, Coal, Eucalyptus, Peat, Saw dust, Rice husk, Lignite etc. It is preapered through Carbonisation & Activation of Organic substance. During Carbonisation most of non-carbon elements, Hydrogen, Oxygen are first removed in Gaseous form & it develops the internal pores and then after it is Activated through Chemical Activation or Steam Activation.In Activation process, it increases the numbers & dimensions of Pores & hence it has large internal surface area.Applications of Activated carbon :Air stripper off gasIts purifies carbon dioxideUsed to purity nitrogen in various plastics manufacturing processUsed as a catalyst support and protectorUsed in gasoline vapour recoveryUsed in recovery of various useful solvents which are emitted out as waste gases in various industriesIn gassifiers to purify the gasesTo remove odors from the air and gasesIt is used in effluent treatment plant to reduce BOD/COD/Color from industrial water.It removes chlorine and organic impurities from drinking water in the last stage filtration in our common house hold filters.It is used as adsorbent of poisonous gases in gas masks for industrial as well as defense purpose.To adsorb moisture from compressed air in paint shopsTo dechlorinate waters in swimming pool and soft drink plantTo remove oil from hot condensateTop quality granular activated carbons are used in the process of gold recovery in which the molten one is passed over a bed of activated carbon where the gold is adsorbed on the carbon and recovered.Used to manufacture catalystRemove of dissolve organic impuritiesBreweries and distilleriesCatalyst carrier in petroleum refineriesIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationIt is used in decolorisation of liquids having impurities with larger pore size i.e sugar solutions, glucose, dextrose,lactose & other starch sugar solutionUsed in decolorisation of vegetable oils and fats and herbal productsIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationAvailable Grades :Pellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbon
Activated Carbon
VIEW DETAILS
Asbestos Powder that we manufacturer is best available quality that anyone can get in India. Our major Product Market is Bharuch, Ankleshwar, Surat, Vadodara, Gujarat , India.. Please Call for best price.We are identified as one of the leading manufacturers, suppliers, wholesalers and exporters of premium quality Asbestos Powder. To provide finest quality, this powder is processed using high quality ingredients that are sourced from certified vendors of the market. We thoroughly check this powder on various parameters like shelf life and precise composition.Features:PurityLonger shelf lifePrecise composition
ASBESTOS POWDER
VIEW DETAILS
We are Best quality of Iron Ore Manufacturer and supplier. We are based on Vadodara, our main business in India is Gujarat and Bharuch, Ankleshwar, Surat, Vadodara.Product Description:Backed by rich industry-experience, we are engrossed in offering Iron Ore.Specification:Ores are rocks from which metallic iron can be economically extractedThese rocks are usually found in the form of hematite (Fe2O3) or magnetite (Fe3O4)Available in different packaging options Features:PurityLonger shelf lifeAccurate compositionApplication of Iron Ore : Welding Electrodes, Chemical Industries
IRON ORE
VIEW DETAILS
Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
Mastertile 25 Grey

INR 469 INR 475
You Save 1.26%

VIEW DETAILS
Non-shrink, cementitious grout for use in general civil engineering worksBASF MasterFlow 718 is a ready to use, non-shrink, natural aggregate cementitious grout for use in general civil engineering works.MasterFlow 718 provides extended working life and high early and ultimate strengths.RECOMMENDED USESMasterFlow 718 is recommended for:• stanchion baseplates and columns;• prefabricated concrete panels and beams;• bridge bearing plates;• anchor bolts and bars;• underpinning;• patch repair works.FEATURES AND BENEFITS• High strength - provides good early and ultimatestrengths which ensure quick return to serviceand long term durability• Non shrink - Hardens free of bleeding,settlement and drying shrinkage when placed atflowable consistency• Flowable consistency - Ensures complete fillingof even intricate voids often without the need forpumping and strapping• Ample working time - remains placeable – up to1 hour - even at high ambient temperatures• Dense, impermeable grout - Provides a goodwatertight seal• Economical - Greater volumes of grout can bemixed and handled with less labour.• Easy to use - requires no special mixingequipment, it can be mixed in a pail using a groutstirrer.• No added chloride – Does not add to chlorideload on structure• Provides complete non shrink performance-When tested in accordance with simulatedBedplate Technique.• Versatile- Can be placed from flowable totrowelable consistency
MasterFlow 718

INR 440 INR 450
You Save 2.22%

VIEW DETAILS
Xylitol is used as a food additive and sugar substitute. Replacing sugar by xylitol in food products may promote better dental health. Sugar substitute.
Xylitol
VIEW DETAILS
Sodium trimetaphosphate available in industrial and commercial grade It is a colourless solid that finds specialised applications in food and construction industries.
Sodium trimetaphosphate

INR 465 INR 475
You Save 2.11%

VIEW DETAILS
Pharma Use Papaverine hydrochloride Crystalline solid grade used in opium alkaloid antispasmodic drug, used primarily in the treatment of visceral spasm and vasospasm (especially those involving the intestines, heart, or brain), and occasionally in the treatment of erectile dysfunction. It is used in the treatment of acute mesenteric ischemia. While it is found in the opium poppy, papaverine differs in both structure and pharmacological action from the analgesic (morphine-related) opium alkaloids (opiates).
Papaverine hydrochloride
VIEW DETAILS
Methylene Chloride (or dichloromethane) is a colourless volatile liquid with a sweet smell. It is extensively used as a chemical solvent. It is insoluble in water but miscible with organic solvents.Methylene Chloride is synthetically produced by reacting methyl chloride or methane with Chlorine gas at 400-5000C. Methane and methyl chloride undergo a series of chain reaction and yield chlorinated products progressively.Methylene Chloride (or Dichloromethane) volatility and its ability to dissolve with numerous organic compounds make it a useful organic solvent for many chemical processes. However, methylene chloride’s ill effect on health has forced the scientists to look for its alternatives.The applications of methylene chloride are: Major use in Pharmaceutical industry Manufacturing of Polycarbonates, Phenolics, Rayon yarn. Solvent for Cellulose Acetates, Photo-resist, Tablet film coatings. Paint and Grease Removing Agent. Fire-Fighting Agent. Extractant for Edible fats, Cocoa, Butter and Essences. Adhesives for Polymethyl Methacrylate. Aerosol Propellant, Refrigerant. Chemical Reaction Media. Low-temperature heat-transfer medium.
Methylene Dichloride

INR 62 INR 65
You Save 4.62%

VIEW DETAILS
Pat Impex is a reputed and leading manufacturer, supplier & exporter of Ferric Alum, Non Ferric Alum, Ammonia Alum & Potash Alum based at Vadodara, Gujarat, India.Alum is essentially aluminium sulphate with empirical formula Al2 (SO4)3.18HO. It is of two types (i) Ferric and (ii) Non Ferric. Ferric alum is a less pure form of aluminum sulphate. It is used in lower grades of paper for loading and sizing purposes. Ferric alum uses bauxite as the raw material. The raw material is cooked with sulphuric acid under suitable conditions. The resultant product is sold in liquid form.#alum-manufacturer, #alum, #ferricalum
Ferric & Non Ferric Alum

INR 9.2 INR 12
You Save 23.33%

VIEW DETAILS
N- ACETYL GLUCOSAMINE Treatment for autoimmune disease
N- ACETYL GLUCOSAMINE
VIEW DETAILS
It is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product.
GLUCOSAMINE HYDROCHLORIDE USP
VIEW DETAILS
Manufacturer and supplier of pharmaceutical grade ACTIVATED CARBON BP USP IP, small and bulk packing available
ACTIVATED CARBON BP USP IP
VIEW DETAILS
Manufacturer, supplier of Borax, USP NF Ph. Eur. Grade
Borax
VIEW DETAILS
We leading surplus & non moving, byproduct, waste grade chemicals & pharmaceutical, apis, drugs, solvents stock buyer & seller based at Vadodara, Vapi, Ankleshwar, Mumbai, Pune, Ahmedabad, Gujarat, India since 2009. We have following surplus chemicals in stock at our Gujarat, India location.Acetic Acid Glacial/pharma/commercial - 100 MtSulpuric Acid Commercial - 200 Mt SurplusNitric Acid Commercial - 100 Mt Surplus Acid ChemicalsSoda Ash Tata/nirma - 45 Mt SurplusCitric Acid China - 30 Mt SurplusEthyl Acetate Tanker - 50 Pvc Drums;42 Kg.Toluene Pass 92 % Moisture 0.8%1 , 4 Dioaxan /pure/ Gc 99.78%/kf 0.2% / 35 Drum/Ipa Cbm Gc 99.9% /kf 12% Water White/ph Neutral/ Tanker Load /qnty 16mt/Methanol Distilled / White/d .0.80/ph Neutral/200 DrumMono Ethyl Amine 70%N Propanol Amine 30 Pvc DrumsFormic AcidToluene Recovered No Smell - 99 % Ms DrumPottasium Sulphate 99%+ 5 Mt /off Whitwhite/99%/powder Form/50 Kg PackingOliec AcidMaliec AnhydrideIso Amyl AlcohalSodium Methoxide PowderSodium Methoxide PowderSodium Methoxide PowderTetra Butyl Ammonium Bro.Tetra Butyl Ammonium Bro.2-5 Di Bromo Pyridine4-cyano PyridineIso Nicotinic AcidP0cl3Nicotinic AcidRuthenium 5% AlluminaTri Ethyl AmineZinc DustMalic AcidAmmonium Chloride2, 6 Dimethyl AnilineTitanium ButoxideActivated Carbon Acg GradeCalcium HydroxideCrotonaldehydeAceton RecoverdDenatonium SaccharideActivated CarbonOxalic AcidBromineIsonicotinic Acid (Comm-gr)Sodium SulphatePottasium Carbonate4-fluoro-2-methoxyaniline4-bromo-2, 6-difluorobenzaldehyde2-bromo-5-fluorobenzoic AcidHydroxylamine HydrochlorideBarbituric AcidAmmonium AcetateDiethyl Amino Malonate HclLithium ChloridePhosphorous OxychlorideVinyl AcetateMethane SulfonamideSodium Bis(2-methoxyethoxy)aluminium HydrideDiethyl Oxalate2-ethylbutyric AcidCopper(Ii)sulphateIsopropyl Magnesium Chloride(2m In Thf)Isopropyl Magnesium Chloride(2m In Thf)MorpholineTrifluoromethane Sulfonic AnhydrideTrifluoromethane Sulfonic AnhydrideIron(Iii)nitrate NonahydrateTin PowderSodium Tert-pentoxideIron(Metal) PowderZinc Dust PowderThioureaFormamidine AcetateHydrazine Hydrate-80%3-methyl-2-butanoneAmmonium Bi CarbonateDimethylamine Hydrochloride
Surplus Chemicals & Pharmaceuticals

INR 2100 INR 2200
You Save 4.55%

VIEW DETAILS
Pat Impex Oilfield’s corrosion inhibitors are used to effectively reduce the corrosion rate of a metal exposed to that environment, thereby extending its lifetime.By nature of its adsorption on solid surfaces, the corrosion inhibitor is a surface-active agent with a unique purpose; to protect pipe rather than to change acid behavior in the formation. Corrosion inhibitors do not stop corrosion; they greatly reduce the reaction rate of acid with steel. Proper selection and application of corrosion inhibitors also reduce pitting (the tendency of acid to corrode or dissolve metal deeply in specific sites). Corrosion inhibitors are cationic and oil wetter’s. This is the mechanism by which they adsorb on a metal surface and form an oil-wet film to protect the iron from exposure to acid. Plating out and oil wetting also occur in the formation, especially on clay minerals. To compensate for this, other additives, such as surfactants and mutual solvents, are used to restore water-wetness and maximize permeability to oil.Pat Impex Oilfield performs extensive laboratory testing in combination with additives to provide data to estimate the time of protection of pipe during the course of acid exposure to tubing in an acid treatment.
Acid Corrosion Inhibitors
VIEW DETAILS
White to Almost Praziquantel white crystalline powder as per IP/BP/EP/USP available.We Pure Chem Pvt Ltd, an ISO 9001:2008 certified APIs and Intermediates manufacturer, supplying Key veterinary APIs like Prazequantel IP/BP/EP/USP for domestic as well as export market.We are now in a field of Veterinary APIs, to offer Key APIs like Prazequantel IP/BP/EP/USP
Praziquantel

INR 8400 INR 8500
You Save 1.18%

VIEW DETAILS
DCDA, Dicyandiamide is a very important intermediate, DCDA, Dicyandiamide is used with other intermediate to manufacture quality products
Dicyandiamide ( DCDA )

INR 210 INR 220
You Save 4.55%

VIEW DETAILS
DCDA, Dicyandiamide is a very important intermediate, DCDA, Dicyandiamide is used with other intermediate to manufacture quality products
Dicyandiamide ( DCDA )

INR 210 INR 220
You Save 4.55%

VIEW DETAILS
Poly Phosphoric Acid Manufacturer, supplier & Phosphorous Derivatives are used in various applications in agrochemical products, flame retardant chemicals, plastic additives, water treatment chemicals, pharmaceuticals and dyes intermediates and many other fine chemicals.
Poly Phosphoric Acid
VIEW DETAILS
We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
Cyanocobalamin Vitamin B12
VIEW DETAILS
We are Authorised sub Distributors of INKABOR SAC from Peru for All India sub distribution of Borax Decahydrate.
Borax Decahydrate
VIEW DETAILS
Manufacturer, exporter & supplier of Ammonium Dihydrogen Phosphate inorganic chemicals. Available in grade of food, LR, AR, ACS, IP, BP, USP along with COA, MSDS and packing.
Ammonium Dihydrogen Phosphate
VIEW DETAILS
Pat impex is a leading manufacturer, supplier, trader of industrial cholic acid importer in India. holic acid, also known as 3α,7α,12α-trihydroxy-5β-cholan-24-oic acid is a primary bile acid[1] that is insoluble in water (soluble in alcohol and acetic acid), it is a white crystalline substance. Salts of cholic acid are called cholates. Cholic acid, along with chenodeoxycholic acid, is one of the two major bile acids produced by the liver, where it is synthesized from cholesterol. These two major bile acids are roughly equal in concentration in humans. Derivatives are made from cholyl-CoA, which exchanges its CoA with either glycine, or taurine, yielding glycocholic and taurocholic acid, respectively.Cholic acid downregulates cholesterol-7-α-hydroxylase (rate-limiting step in bile acid synthesis), and cholesterol does the opposite. This is why chenodeoxycholic acid, and not cholic acid, can be used to treat gallstones (because decreasing bile acid synthesis would supersaturate the stones even more).
Cholic Acid

INR 13824 INR 13899
You Save 0.54%

VIEW DETAILS
Klucel hydroxypropyl cellulose (HPC) is a nonionic water-soluble cellulose ether with a remarkable combination of properties. It combines organic solvent solubility, thermoplasticity and surface activity with the aqueous thickening and stabilizing properties characteristic of other water-soluble cellulose polymers available from Ashland. Klucel HPC films are flexible without plasticizers and non-tacky at high humidity.
Klucel hydroxypropylcellulose
VIEW DETAILS
Tartaric acid is used as an acidifier, flavour enhancer, antioxidant, stabilizer and sequestering agent. Looking for buy ? Please contact us. Made by INDUSTRIA CHIMICA VALENZANA
Tartaric acid
VIEW DETAILS
1,4,7-Triazacyclononane is a macrocyclic polyamine and its derivatives are extensively used as catalysts, chelators for medical imaging and bleaching agents. With the utilization of modern processing techniques and technology, we are able to manufacture a dependable range of 1,4,7-Tritosyl-1,4,7-triazonane, 1H-1,4,7-Triazonine, and more. These are prepared in our in-house processing facility under the stern observation of researchers, experts while adhering to strict quality assurance at all levels. Streamlined chemical reaction process allows us to produce unmatched quality 1,4,7-Triazacyclononane with assured features and characteristics. Further, these are provided at industry leading prices and are packed safely in glass bottle to restrict leakage during transit.
1,4,7-Trimethyl-1,4,7-Triazacyclononan
VIEW DETAILS
1-Bromonaphthalene LR AR finds the most common application for determination of crystals refraction and as embedding agent for microscopy. Its chemical formula is C10H7Br with the molar mass of 207.07 g/mol and density of 1.48 g/ml. This compound has a very high refractive index and shows the melting point of about 1 to 2 degrees Celsius with a boiling point range of 132-135 degrees C. It is a colorless organic liquid that can industrially be produced by the reaction of naphthalene with bromine. 1-Bromonaphthalene LR AR offered by us is highly pure in nature and is available at reasonable prices in large quantities. Because of its high refractive index, 1-bromonaphthalene is used as an embedding agent in microscopy and for determining the refraction of crystals.The compound is also used as a precursor to various substituted derivatives of naphthalene. Effective determines crystal refraction Functions as embedding agent Includes elevated refractive index The organic and colorless fluid material
1-Bromonaphthalene

INR 6127 INR 6200
You Save 1.18%

VIEW DETAILS
Our company is instrumental in presenting an electrochemical grade of lithium chloride. Our lithium chloride is extensively used as a component of the electrolyte in lithium batteries. It is also used as a desiccant for drying air streams.
LITHIUM CHLORIDE 40%

INR 475 INR 480
You Save 1.04%

VIEW DETAILS
We export Sodium Formaldehyde Bisulphite, which is a white, shining, crystalline material. These are chemicals are used in an application like lithography & photographic use and x-ray fixer & platting. Moreover, it also used to control metallic impurities in a bright nickel bath.
Formaldehyde-sodium bisulfite adduct 9
VIEW DETAILS
We are one of the leading suppliers and importer of Thiamine Hcl Vitamin B1, used in pharmaceutical, food, dairy, beverages industries.
Thiamine Hcl Vitamin B1
VIEW DETAILS
Polymethyl Methacrylate PMMA or acrylic is a widely used transparent plastic material known for its applications in various markets from car windows, smartphone screens to aquariums. It is a tough plastic, easy to shape and a great alternative to the high cost and less resilient glass.GSFC make Polymethyl Methacrylate available at lowest price.
Polymethyl Methacrylate
VIEW DETAILS
We manufacture and supply Best quality of Hydrated Lime Manufacturer, We are vadodara based manufacturer, our Quality analysis department and Research and development department make sure that our quality is superior to our all competitors.Our organization provides a wide assortment of Hydrated Lime Manufacturer, which is widely used for construction purposes. We assure premium quality of our range since, we our quality analysts rigorously check the entire procured line of products. When used as a building material, Hydrated Lime is highly cost-effective. Further, these reduce the reaction time of chemical reactions, owing to its purity.All Grades Hydrated Lime Available in stock ex. Vadodara, Gujarat, India.Application of Hydrated Lime : Construction, ETP, Paint and chemical Industry in India.
Hydrated Lime Powder
VIEW DETAILS
Composite acrylic polymer based cementitious crack resistant flexible waterproofing coating, MoistureZero is formulated specially for use in combination with all kinds of cement blends.It is to be used in cementitious slurries as a polymerizing agent and modifier to enhance durability of slurry against moisture ingress along with resistance to hair line cracks.Better performance as compared to similar products like Tapecrete P151 or others.Sunken areasWater bodiesTerraces where roof garden not presentCoverage:It depends on the substrate type (smooth or rough) and application skills.On Smooth Concrete 1Kg / 2 Coats / 15-20 Sq. FtOn Smooth Concrete 1Kg /3 Coats with Fibre layer / 8-12 Sq. Ft
BUILDSMART BS MoistureZero

INR 235 INR 252
You Save 6.75%

VIEW DETAILS
Pat Impex is a leading dealer & distributor of BASF MasterEmaco 131, BASF MasterEmaco 131, BASF MasterEmaco 488, BASF MasterEmaco S 346, BASF MasterEmaco S 348, BASF MasterEmaco SBR 2, BASF MasterEmaco SBR 2.BASF’s MasterEmaco product system under the Master Builders Solutions brand offers comprehensive solutions for concrete that has been damaged or deteriorated by changing weather conditions, chloride ions, contaminants and extreme environments.The MasterEmaco portfolio of primers, cementitious and resinous repair mortars and fairing coats make up a complete system approach that is used to substitute deteriorated concrete and re-establish the original strength, structural integrity and aesthetics.Formulated to be wet or dry spray applied, formed or hand troweled, the MasterEmaco line of superior performance products re-establish the long-term durability and load bearing capacity of concrete. Working quickly to allow a fast return to service, they match the concrete’s strength, improve the aesthetics and prolong the lifecycle of the building or structure.
MasterEmaco

INR 33 INR 38
You Save 13.16%

VIEW DETAILS
It is a free flowing white crystals, very slightly soluble in water and in other acids.It is used in manufacturing of Titanium, and manufacturing of Aluminium Titanium Boron alloys for grain refining of aluminium metal. It increases the strength of aluminium metal and its alloy.
Potassium Hexafluorotitanate
VIEW DETAILS
Pat Impex, a leading importer of CELPHERE Asahi Kasei Corporation , CELPHERE™ is a 100% microcrystalline cellulose (MCC) spheres. It is a neutral substrate for manufacturing of microgranules. It has no smell nor odor. It is insoluble in organic solvents such as ethanol. We have all brands of CELPHERE, CELPHERE SCP-100, CELPHERE CP-102, CELPHERE CP-203, CELPHERE CP-305, CELPHERE CP-507 available in stock.
CELPHERE microcrystalline cellulose
VIEW DETAILS
Pat impex is a leading importer and suppliers of innophos brand Dicalcium & Tricalcium Phosphate. Available in 25 kgs and 50 kgs packing. Other innophos brands CALIPHARM A-D-T, DI-TAB, NUTRA TAB, TRI-TAB, VERSACAL MP available in stock.
Innophos Dicalcium & Tricalcium Phosph
VIEW DETAILS
Calcium Carbonate precipitated ApplicationPrecipitated Calcium Carbonate is used as paper coating for premium quality paper productsRubber IndustriesPVC/ Plastic industriesFlattering agent in Paint IndustriesIn thermal & electrical InsulatorsFor making Tooth PastePharmaceuticalsFood industriesPCC is synthetically processed from naturally occurring high grade lime stone.The major advantage of the product is its availability in different bulk densities from 0.40 gms/cc to 0.9 gms/cc, with brilliant white color, depending upon the requirement of end user.The assay (purity) of material is around 98.0 % as CaCO3. The material is fluffy and free from inclusions.
Calcium Carbonate Precipitated
VIEW DETAILS
Importer & suppliers of ADENOSINE MONOPHOSPHATE. Adenosine monophosphate (AMP), also known as 5'-adenylic acid, is a nucleotide. AMP consists of a phosphate group, the sugar ribose, and the nucleobase adenine; it is an ester of phosphoric acid and the nucleoside adenosine. As a substituent it takes the form of the prefix adenylyl.
ADENOSINE MONOPHOSPHATE (AMP)
VIEW DETAILS
High quality ACITRETIN pharma neutraceuticals available with us. We are a self importer of this products in 1 kg & 5 kgs packing. Available in stock
ACITRETIN
VIEW DETAILS
Ammonium Bromide is known as Ammonium Bromatum, Azanium bromide, Nervine, Ammonium bromide ((NH4)Br) and has Molecular Formula of BrH4N and Molecular Weight of 97.94246. It is manufactured through passing bromine in aqueous solution over iron filings which leads to the formation of ferric & ferrous bromide solution that is further treated with ammonia.Available in form of cubic, colloidal crystals or as white crystals/granules or as colourless crystals or in form of yellowish-white crystalline mass, it is odourless in smell and has a saline taste. Its other properties include Boiling Point of 235°C (vacuum), Melting Point of 452°C sublime, Density/Specific Gravity at 2.429 @ 25°C and solubility in ether, ammonia, acetone and in water.
Ammonium Bromide
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter and supplier of Phenyltrimethylammonium Chloride 98% powder. This compound used in :Surface-active agentsSolventsIntermediatesActive Ingredient for ConditionersAntistatic AgentDetergent SanitisersSoftner for textiles and paper productsPhase Transfer CatalystAntimicrobialsDisinfection Agents And SanitizersSlimicidal AgentsAlgaecideEmulsifying AgentsPigment Dispersers
Phenyltrimethylammonium Chloride

INR 275 INR 300
You Save 8.33%

VIEW DETAILS
We are a importer & suppliers of Nitrofurantoin pharma raw material in India. Nitrofurantoin is an antibiotic that fights bacteria in the body. Nitrofurantoin is used to treat urinary tract infections. Nitrofurantoin may also be used for purposes not listed in this medication guide.
NITROFURANTOIN
VIEW DETAILS
We are offer to sell Indian Peanut or Groundnut oil EP & BP Pharma grade. Offer to sell high quality groundnut oil that is mostly used by pharmaceutical and food industries in India.
GROUNDNUT OIL EP & BP Pharma Grade
VIEW DETAILS
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
Caustic Soda Flakes

INR 1599

VIEW DETAILS
Manufacturer, exporter & supplier of Readymade shampoo base chemicals for the manufacturing of shampoo process at the very lowest price. We are a largest manufacturer of shampoo base raw material in India.
Readymade Shampoo Base Chemicals
VIEW DETAILS
We are a unique entity in the market, actively committed towards offering an optimum grade of China Clay Powder. Under the stern vigilance of dexterous professionals, our offered powder is processed using premium quality chemical compounds and sophisticated processing techniques. For its accurate composition, our provided powder is widely appreciated among our patrons. Sourced from authentic vendors, quality examiners check this powder against diverse quality parameters to avoid any possible flaws.Major Uses: PVC cables high voltage insulating materials Low and medium voltage electric cable insulation Mechanical rubber goods Elastomers PVC Polyamide Other plastic / rubber applicationsApplication Rubber MB
China Clay Powder
VIEW DETAILS
By efficiently understanding the market trends, we are able to manufacture, supplied and trading of Calcium Asparto Glycinate. We offer pure grade powder of Calcium Asparto Glycinate for pharmaceutical tablet manufacturer in India.
Calcium Asparto Glycinate
VIEW DETAILS
Leading manufacturer & supplier of Acetonitrile solvents.Leveraging the skills of our qualified team of professionals, we are instrumental in offering a wide range of Acetonitrile Solvent.Ethanenitrile, Cyanomethane, Ethyl nitrile, Methanecarbonitrile, Methyl cyanidePurity 99.5% MinimumDensity (g/Cm Cube) 786 kg/m3Boiling Point (deg. Celsius) 82Melting Point -45Molar Mass 41.05 g/mol
Acetonitrile

INR 183 INR 190
You Save 3.68%

VIEW DETAILS
We are counted as one of the leading suppliers and traders, offering the best quality of Acetone Chemical Compound & Solvents. Due to its accurate composition and longer shelf life, the offered vinyl acetate monomer is highly demanded. Due to our rich vendors’ base and spacious storage facility, our patrons can avail the offered vinyl acetate monomer in bulk quantities, as per their needs and requirements. Features:Compositional accuracyEnhanced shelf lifeHigh density
Acetone

INR 47 INR 52
You Save 9.62%

VIEW DETAILS
Distributors, Stockist, Importers, Agents of Chemours BASF Titanium Dioxide rutile R 105-706-350Superior weather resistanceOutstanding properties in molding and extrusion resinsExcellent opacity and neutral undertoneVery high dispersibility in plasticized vinyl, plasticizers, and liquidsFlocculation resistanceGood gloss retentionResistance to chromaphore formationApplications where Ti-Pure™ R-105 is of particular value are:Injection molding, blow molding, and blown film of polyethylene or polypropyleneRigid interior, flexible, and plastisol PVC, as well as PVC used for composite and sheet flooringLead-stabilized PVC systems and nonchalking exterior PVCDurable exterior polyethylene or polypropyleneExterior architectural applications requiring high gloss and maximum durabilityEmulsion trim paints where maximum initial gloss and outstanding exterior durability are preferredRefinish and OEM topcoat applications requiring high gloss, distinctness of image, and resistance to weatheringManufacturing operations demanding fast wet-in and easy dispersionHigh-durability industrial applications including coil coatings for residential aluminum siding, architectural building panels, and aerospace coatingsThermoplastic masterbatches needing high concentrations of pigment and minimal melt flow impactPolyolefin products with improved resistance to additive yellowingPolyolefin films for outdoor applicationsABS ApplicationsAutomotive OEM topcoat and refinishAerospace coatingsPremium-quality exterior finishes and high durability exterior coil coatingsPowder coatingsIndustrial OEM
Chemours Titanium Dioxide Rutile R 105

INR 275 INR 280
You Save 1.79%

VIEW DETAILS
Chemours (BASF) Distributors, Stockist, Importers, Agents Rutile Ti-Pure™ R-104 is a general-purpose rutile titanium dioxide pigment designed primarily for plastics applications. Manufactured by the chloride process and supplied as a fine, dry white powder, it is specifically formulated toOffer fine particle size distributionGive outstanding melt flow with highly loaded thermoplastic masterbatchesCombine high brightness and high tinting strength with the bluest vinyl undertoneOffer excellent lacing resistance in high-temperature cast film and extrusion coating applicationsApplications where Ti-Pure™ R-104 is of particular value are:Engineering resin applications where high opacity at low loading is requiredThermoplastic masterbatches where high concentrations of pigment are desiredMelt flows that are minimally affected
Chemours Titanium Dioxide Rutile - R-1
VIEW DETAILS
The substance is also used for parasite control and for drinking water disinfection. Chloramine-T is as an algicide, bactericide, virucide, fungicide (including spores), germicide. It is also effective against mycobacteria such as tuberculosis, foot-and-mouth disease and avian influenza.Tosylchloramide or N-chloro tosylamide, sodium salt, sold as chloramine-T, is a N-chlorinated and N-deprotonated sulfonamide used as a biocide and a mild disinfectant. It is a white powder that gives unstable solutions with water. Trade names of chloramine-T products include Chloraseptin, Chlorazol, Clorina, Disifin, Halamid, Hydroclonazone, Trichlorol, Minachlor, and generic Chloramin T or Tosylchloramide Sodium, among others.Iodination and radioiodinationBiocideProtective agent
Chloramine T
VIEW DETAILS
We are one of the prominent manufacturers, exporters and suppliers of high quality Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical. Offered chemical is processed in a very hygienic environment by utilizing quality approved chemical substances. This chemical finds broad applications in cosmetic and soap industry for adding soothing fragrances. Further, this chemical is tested on various quality parameters to ensure its high effectiveness. Besides, our clients can obtain this Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical from us in different packaging options at nominal rates.Application in : Incense Sticks ( Agarbatti ), bakhoor, dhoop & loban, Fine Fragrances & Soap Perfumes, Detergent Powders, Cosmetics & Toiletries.
Yara Yara Beta Naphthyl Methyl Ether

INR 350 INR 360
You Save 2.78%

VIEW DETAILS
The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
Zeolite 4A

INR 22 INR 25
You Save 12%

VIEW DETAILS
Our company has succeeded to achieve respectable position in the market by offering our clients Sodium Meta Silicate Anhydrous. Sodium metasilicate anhydrous is strongly alkaline, having strong capacity of cleaning, buffering and softening, counteracting acidic contamination, emulsifying fat and oil, deflocculating to inorganic. Sodium metasilicate anhydrous is an inorganic white powder or crystalline granules, non-toxic, tasteless and environment-safe. It is easy soluble in water, insoluble in alcohol or in acid producing an alkaline solution, very hygroscopic when reacting with CO2 and water from the air. Applications:Metal treatment chemicals,Ceramic Industrial ,DetergentCleaning powder,Specialty Chemicals
Sodium Metasilicate

INR 51 INR 55
You Save 7.27%

VIEW DETAILS
Lithium Carbonate Manufacturer Lithium carbonate is an inorganic compound, the lithium salt of carbonate with the formula Li2CO3This white salt is widely used in the processing of metal oxides.For the treatment of bipolar disorder, it is on the World Health Organization's List of Essential Medicines, the most important medications needed in a basic health system.Other names : Dilithium carbonate, Carbolith, Cibalith-S, Duralith, Eskalith, Lithane, Lithizine, Lithobid, Lithonate, Lithotabs Priadel, ZabuyeliteCAS Registry Number: 554-13-2Chemical formula : Li2CO3
Lithium Carbonate
VIEW DETAILS
We are one of the reliable organizations engaged in providing clients with Ferrous Sulphate Powder, which is reckoned for its purity. In this product range, we also offer Ammonium Ferrous Sulphate and Ferrous Sulphate Monohydrate to our clients. The entire range of chemicals offered by us is processed at the vendors' end under hygienic and sterile environment. Clients can avail these chemicals in high-grade packaging of varied quantities, as per the requirement. Price may vary.
Ferrous Sulphate

INR 17 INR 24
You Save 29.17%

VIEW DETAILS
We are a manufacturer & supplier of Zinc Sulphate Heptahydrate zn 21% in India.As Mordant in Calico-Printing; Preserving Wood & Skins; with Hypcochlorite for Bleaching Paper, Manufacturing Lithopone & other Zinc Salts; Clarifying Glue; Electrodepositing Zn; also as reagent in analytical Chemistry.
Zinc Sulphate Heptahydrate

INR 34 INR 42
You Save 19.05%

VIEW DETAILS
We are a manufacturer & suppliers of Lithium Acetate dihydrate, anhydrous & solution in India.Lithium acetate dihydrate is a salt of lithium and acetic acid. Lithium acetate dihydrate is used in ester interchange catalyst in polyester production, anticorrosion agent in molding polyphenylene sulfide resins, and a catalyst in alkyd resin and acrylic polymer production.
Lithium Acetate Anhydrous
VIEW DETAILS
Boron is an ideal Boron Fertilizer. It increases profit by maximizing yield. With sincere efforts, we have successfully been engaged in manufacturing and supplying a superior quality of (Boron-10%). This is processed with the use of boron chemicals and by the aid of sophisticated techniques under our adroit professionals. It is used in foliar and drip irrigation applications as insecticides, pesticides and fungicides. In addition to this, the offered (Boron-10%) is available in the market at reasonable prices from us.Benefits:It helps in new cell formation and root developmentIt helps in formation of protein and amino acidIncrease number of flowers and fruitEnsures growth and high yield of all cropRecommended Crops:Wheat, Maize, Sugarcane, Rice, Sorghum, Cotton, Pigeon Pea, Sunflower, Groundnut, Soybean, and Vegetables like Tomato, Brinjal, Chilly etc., all types of Fruits Crops and Tea & Coffee.
BORON 10%

INR 105 INR 110
You Save 4.55%

VIEW DETAILS
Formulated using Phosphorous 52% and Potassium 34%, Special NPK (00-52-34) is a 100% water soluble fertilizer which promotes the soil fertility. It is a great source of P & K soil nutrients for plants, specially useful during early and end stages of crop growth.Content:N (Nitrogen) : 00%P (Phosphorous): 52%K (Potassium) :34%Advantages:Complete Plant FoodHighest Nutrition ContentExcellent Chemical PropertiesSuitable For Fruit DevelopmentIt's Good Vegetative Development Gives Scope For Good YieldRecommended Crops:Cereals & Fibres ( Rice, Wheat, Maize, Cotton, etc.).Tomato, Onion, Potato, Groundnut, Sugar Beets, Legumes other Vegetables crops.Commercial crops like Sugarcane, Tea & Coffee, etc.Fruits ( Grapes, Mango, Apple, Banana, Citrus, Strawberry, Pomegranates etc.) and other fruits.Flower ( Roses, Marigold, Carnation, Gerbera etc.) & other flowers.Dosage & Application:Foliar Application:- 100 gm per pump or 15 litre water.Soil Application: - 5 kg per acre.Packing Available: 1 kg, 25 kg & Bulk.
NPK 00:52:34

INR 85 INR 90
You Save 5.56%

VIEW DETAILS
We are a importer & suppliers of 1, 2, 3 Benzotriazole (BTA) that is used in antirust oil (grease) products, widely used in air phase corrosion inhibitor and circulating water finishing agent in copper and copper alloy, motor vehicle antifreeze fluid, photo antifoggant, macromolecule stabilizer, plant growth regulator, lubricating oil additives, ultraviolet absorber etc. It can be also used with various antisludging agent and germicidal agent.
1, 2, 3 Benzotriazole (BTA)

INR 670 INR 680
You Save 1.47%

VIEW DETAILS
We are a importer & supplier of Gluconic Acid 50%.Gluconic acid is an organic compound with molecular formula C6H12O7 and condensed structural formula HOCH2(CHOH)4COOH. It is one of the 16 stereoisomers of 2,3,4,5,6-pentahydroxyhexanoic acid.Gluconic acid occurs naturally in fruit, honey, and wine. As a food additive, it is an acidity regulator. It is also used in cleaning products where it dissolves mineral deposits especially in alkaline solution. In aqueous solution at neutral pH, gluconic acid forms the gluconate ion. The salts of gluconic acid are known as
Gluconic Acid 50%

INR 75 INR 80
You Save 6.25%

VIEW DETAILS
We are proficient in supplying a wide range of Anhydrous Ammonia that is largely utilized by our customers in nitrogen fertilizer. According to the convenience of the customers, we are delivering this chemical substance in a variety of cylinder sizes like 40, 50, 60 and 225 kg. So as to cater to the exact necessities of the users, we are supply this chemical pure forms varying from 95.5% to 98.5% in tankers and cylinders sizes.
Anhydrous Ammonia

INR 120 INR 125
You Save 4%

VIEW DETAILS
We have achieved a unique position in the industry by offering our customers an excellent range of Aluminium Nitrate. Used in varied industries, the offered range is processed under the observation of adroit professionals, who are well-versed in this domain. Product Details:EffectiveAccurate compositionEnsures purityEco
Aluminium Nitrate

INR 127 INR 145
You Save 12.41%

VIEW DETAILS
Offer to sell Sodium Sulphite (sulfite) solution at best price. We offer 15% sodium sulfite solution specification in Tanker Load and small packing. Byproduct, waste and surplus sodium suphite solution available.
Sodium Sulphite Solution
VIEW DETAILS
With innovative approach, we are able to offer high quality range of zircon sand. These are prepared utilizing zircon, which is a top quality raw material which is available in bulk with us. Further, this sand is finished in such a manner that these are able to retain their shine for the lifetime. This sand is obtainable in wide ranging specifications and is available at reasonable prices to our customers.
Zircon Sand

INR 82 INR 85
You Save 3.53%

VIEW DETAILS
Pat Impex is a leading importer and supplier of Polyvinyl Chloride PVC Resin. We are a importer of Polyvinyl Chloride PVC Resin from Thailand, Gulf Countries, LG, Hanwha, ocean, georgia, ineos in India.
Polyvinyl Chloride PVC Resin
VIEW DETAILS
Pat impex india is a exporter, manufacturer, supplier of pharmaceutical Blonanserin which is used in pharma formulations, tablets, pharma intermediates, pharma chemicals. We are approved by GMP and other certification for this product. Please contact for price and other details.
Blonanserin

INR 625000

VIEW DETAILS
Buy high quality polyelectrolyte (Grade - Anionic, Cationic, Non Ionic) manufacturer, supplier, exporter, importer, dealer based at Vadodara, Gujarat, India for waste water treatment, etp treatment, water purification, oil recovery, color removal, paper making, mineral processing. It has anionic emulsions and dry polyacrylamides which can be used wherever liquid/solids separation is needed in industrial effluent treatment applications.
Polyelectrolyte
VIEW DETAILS
Peracetic acid is an environmentally safe and versatile anti-microbial agent and a powerful antioxidant. It emits oxygen at lower temperatures than other bleaching agents. It is effective against micro-organisms and is not deactivated by catalase and peroxidase, the enzymes that break down hydrogen peroxide. It is widely used in food applications.Dairies, wineries, breweries and beverage plants,Meat and poultry processing and packaging,Milk and dairy products processing and packaging plants,Seafood and produce processing and packaging plants,Food processing and packaging plants,Egg processing and packaging equipment surfaces,Eating establishments
Peracetic acid
VIEW DETAILS
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
Isopropyl Alcohol
VIEW DETAILS
Buy high quality Caustic Soda Flakes, Prills, & Lye gacl/meghmani/dcm make manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Caustic Soda Flakes, Prills, & Lye
VIEW DETAILS
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
2-Amino-5-chlorobenzophenone

INR 22000

VIEW DETAILS
Buy high quality Ambroxol Hydrochloride Hcl manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
Ambroxol Hydrochloride Hcl
VIEW DETAILS
Buy high quality Salbutamol Sulphate IP/BP/USP(CAS 51022-70-9) manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Salbutamol Sulphate IP/BP/USP

INR 6500

VIEW DETAILS
Buy high quality ALBUTEROL SULPHATE manufacturer, exporter, suppliers for pharmaceutical, bulk drugs, intermediates in Vadodara, Gujarat, India.
ALBUTEROL SULPHATE
VIEW DETAILS
High quality pharmaceutical apis bulk drugs intermediates suppliers & manufacturer of ergotamine tartrate from Vadodara, Gujarat, India. Available now in south america, europe, india and worldwide
Ergotamine Tartrate
VIEW DETAILS
Buy high quality Acriflavine hydrochloride hcl powder manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Acriflavine hydrochloride hcl powder
VIEW DETAILS
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
Aceclofenac
VIEW DETAILS
Pat Impex is a leading suppliers, exporters, importer, manufacturer of 4-(Piperidin-4-yl)morpholine in small and bulk packing pharmaceutical api intermediates for pharma manufacturing in India, Gujarat, Worldwide.
4-(Piperidin-4-yl)morpholine
VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
N,N-Diisopropylethylenediamine
VIEW DETAILS
Pat Impex is a leading manufacturer & exporter of Sodium Hypochlorite solution 1-14% in Vadodara, Gujarat, India. Manufacturer Capacity - 1,00,000 MT/AnnumExporter & Importer in Dubai, UAE, Saudi Arabia, Europe, USA, Canada, South America
Sodium Hypochlorite
VIEW DETAILS
#Povidone Iodine suppliers in South America, Europe, Asia.Pat Impex is a leading suppliers, exporters, manufacturer of Povidone iodine in small and bulk packing available in Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Guyana, Paraguay, Peru, Suriname, Uruguay, Venezuela, South America & Europe.
POVIDONE IODINE BP USP IP

INR 2700 INR 2800
You Save 3.57%

VIEW DETAILS
Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
TRICHLOROISOCYANURIC ACID - TCCA 90%

INR 230 INR 235
You Save 2.13%

VIEW DETAILS

Filter using tags

sodium hypochloritesouth americausaindiauaeimportercanadaeuropemanufacturerduabiexportertop chemical company in india4-(Piperidin-4-yl)morpholineasiasupplierafricaaustraliarussiaamericaPHARMACEUTICALSPHARMACUTICALSpharmaceuticalTopiramateBromhexine hydrochlorideCalcium levulinatepharmaceuticalsFerric ammonium citratePharmaceuticallaboratoryPharmaceuticalscbsx basf powderDetergent chemicalsoptical brightenerpaper brightenerfiber whitenertextile whitenercolor correctionpharmaceutical intermediatesapisbulk drugs manufacturer in indiagujaratsupplierspharmabulk drugsapiukintermediatesSalbutamol Sulphate IP/BP/USPsorbitolliquidsolutionpowderin indiaworldwidesorbitol 70% solutiondealerdistributorWith the strong knowledge of this domain, our chemExcellent AntisepticFeatures:High effectivenessZero side effectsLonger shelf lifeChlorhexidine Acetate BP/EP/USPCarbamazepinePHARMCEUTICALSClioquinolFluphenazine DecanoategranulesbentonitelumpsQuaternary Compoundsbleaching agentoxidizing agentchemicalsPharmaceutical excipientsAshlandspeciality ingredientsOxidizing agentspaper industryr-902titanium dioxiderutiledupontacetoneSolventspure grade solventsForemost 310Crystalline MonohydrateKERRY Ingredient USAACITRETINIndiaMasterEmacobasf1-Bromonaphthalenerefractive indexembedding agentbromine chemicals4-Methoxybenzoic Acidp-Anisic AcidDraconic AcidActivated Carbonipbpusppharmaceutical grade carbonGlycerine CPVVFAdani WilmarGodrejnirma glycerineHydrogen Peroxidechlor alkaliDiphenhydramine HclClopidogrel BisulfateVinorelbine tartrateFurosemideBetahistine DihydrochlorideCalcium Dobesilatecosmetic chemicalsPHARMACEUTICALPLithium carbonatemaharasthraHydrofluoric Acidindustrial acidtechnicalcommercialAmmonium BisulphiteOxygen Scavengeroil & gasoilfield chemicalsWhite Phenylliquid cleanerfloor cleanerH2S Scavengeroil field chemicalsdubaiqatarsaudi arabiaMethylene Dichloridechloromethane groupvadodaraMastertile 25 Greyconstruction chemicalsConstruction Chemicals in Indiafuso chemicalmalic acidfcc gradeValproic AcidVoriconazoleEconazole NitrateClorsulonCyproheptadineSeaweed Extract Flakebiochemical fertilizerorganic fertilizerAceclofenachigh qualitytop pharma company in indialowest rateAcriflavine hydrochloride hcl powdertop companyr & dpharma compoundPovidone Iodinetbabmanufacturer of tbab in indiaphase transfer catalystTetrabutylammonium Bromide4-n-butyl ResorcinolDocusate SodiumTerbutaline Sulfatepigments chemicalsN-Propyl Bromidedyes chemicalsfood chemicalsChlorine chemicalsbleaching powderAgriculture chemicalsinorganic chemicalsantifreeze fluidantifoggantpgrantisludinggermicidal agentantirust oil greasecorrosion inhibitortablet bindertablet manufacturerAMMONIUM ADIPATEfood industryingredientsmineral fortifiersAmmonium benzoatefoodrust inhibitorpreservativeadhesives ingredientscoating industryPotassium Hexafluorotitanatenavin fluorine dealerSugar SweetenerMethyl isobutyl ketone (MIBK)mibk solventstop solvents manufacturer in India4-Amino-6 Chlorobenzene-1,3-disulfonamideChloraminophenamideIdoresepharma intermediatessolvent c9relianceopeldistilledc9 solvents in indiasolventsupppliersALBUTEROL SULPHATEnorth indiaAPISahmedabadvapigermanysouth indiaankleshwarprillslyeflakescaustic sodapoviArgentina, Bolivia, Brazil, Chile, Colombia, Ecuadpat impexbasf tamoltamol dnpharma intermediatePregabalinAmiloride Hcllactosepharma excipientsfertilizersoil nutrientsAgriculturecrop protectionAluminium NitrateManufacturerReadymade Shampoo Base Chemicalsshampoo raw materialshampoo manufacturing chemicalscalcium carbonate precipitatedgacladitya birlarayoncentury birlaindian peroxidenational peroxideHydrogen Peroxide 35%, 50%, 60%, 70% w/wSodium trimetaphosphateIndustrial chemicalscommercial gradeHydrogen Bromidehbr solutionacetic acidhydrobromic acidbromide derivativesMethanesulfonic anhydrideexportersWhite Petroleum JellyChlorhexidine Gluconateall indiaCoco MonoethanolamideAnhydrous Aluminium Chloridechlorinealkali chemicals4-(N-Boc-amino)piperidineantagonistCAS 73874-95-0PVP K 90 AshlandPharmaceutical Impuritieschemical impuritiesNitrofurantoinhyderabadchennaiDicalcium PhosphateTricalcium PhosphateCALIPHARM A-D-TDI-TABNUTRA TABTRI-TABVERSACAL MPFood & Nutraceuticals IndustryInnophos1,4,7-Triazacyclononanechelatorsmedical imagingGLUCOSAMINE SULPHATE SODIUM CHLORIDE- USPBoraxpheurgradePVC ResinPolyvinyl ChlorideDesloratadineAcefylline piperazineDiphenoxylate hydrochlorideGlipizidesilica sandwhite sandquartzJRS PharmaBASF ExcipientsContract ManufacturingBulk DrugstabletchemoursmeghmaniDCM ShriramGrasimAmmonium Bromideroastedblack granulessteam coalPolymethyl MethacrylatepmmagsfcacrylicplasticizersThiamine HclVitamin B1Tartaric acidINDUSTRIA CHIMICA VALENZANA2-Cyanoacetamide2-CHLOROETHYL MORPHOLINE HYDROCHLORIDEdrug intermediatesSodium Trimetaphosphatedairy stabilizing agentmeat processingcheese stabilizerpharma gradestarch industrySodium carboxymethylcelluloseCosmetic Chemicalsfertilizerscrop growthLithium Acetatedihydratelithium anhydrousferrous sulphatemonohydrateammoniumteepol b 300RECKITT BENCKISER teepol bindia teepol suppliersHydrated LimeGlitter Powdertextilecalcium carbonatebp uspip 85 96ph eur2-CHLOROETHYL AMINE HYDROCHLORIDEiron oremineralsbyproducthydrochloric acidtanker loadsurplus chemicalsgacl hydrochloric acid dealer in indiahcl 32%carboys packinghclsurplus acidperacetic acidperoxy acetic aciddairy chemicalsegg chemiclasseafood chemicalsmilk & dairy chemicalsfood processing chemiclasbiocidesVardenafil Hcl TrihydrateBlonanserinformulationPotassium iodideVenlafaxine HclCetirizine Di Hcl1-Chloroethyl cyclohexyl carbonatecelluloseCalcium Chloride Liquidbest gravitymanufacturer of liquid calcium chlorideceramic morbidetergentmetal treatmentVadodaraMorbiGujaratperfumery chemicalsperfumery chemicals manufactureragarbattidetergent powdercosmeticsUttar pradeshMadhya PradeshPhenyltrimethylammonium Chloridelithium chloride solutionlithium chloride 40%Treatment for autoimmune diseaseN- ACETYL GLUCOSAMINEbulkAlkyl Dimethyl Benzyl Ammonium ChlorideBenzalkonium Chloridebkctamol nntamolChloramphenicol PalmitatePromethazine HCLChlorhexidine and its saltsconcreteMetakaolinwall puttyFexofenadine HCllactose, pharma excipientsInorganic ChemicalsexcipientsPhase transfer catalystsurfactantEmulsifiersflame retardantion exchangebuysalesell2-Amino-5-chlorobenzophenoneipaisopropyl alcoholsolventsthailandsmall packingbulk packingFerric ChlorideWater treatment chemicalschina clay powderDextromethorphan HbrPaint IndustryPaint Additiveschloramine TMIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERNFormaldehyde-sodium bisulfite adduct 95%Formaldehydelithium chlorideklucelashlandCyanocobalaminvitamin b12Sodium nitratedeepak nitrite ltddeepak sodium nitratewastesodiumnitrateBis(2-chloroethyl)amine hydrochloride 98%N,N-Diisopropylethylenediamineanionicpolyelectrolyteeffluent treatment chemicalsnon ionicwaste water treatmenteffcationicwater treatment chemicalsetp chemicalspolyacrylamidesmanufacfurerWater Treatment ChemicalsLauric Monoethanolamidefatty acidsamideCoco DiethanolamideTinidazoleEsomeprazole MagnesiumfreshrecoverLaboratory chemicalsBlue acidsubstitutetextile industriesBASF PEGBASFdupont chemours dealergroundnut oilpeanut oila-tabinnophosdicalcium phosphateAmmonium Dihydrogen Phosphatefood, LR, AR, ACS, IP, BP, USPUSAAcid Corrosion Inhibitorsindustry3-(3-dimethylaminopropyl)carbodiimideEDCEDACEDCInon ferric alumferric alumMasterFlow 718ASBESTOS POWDERasbestos mineral powderrajasthanChlorpheniramine Maleategoabest chemical companyswimming pool chemicaltcca 90%trichloroisocyanuric acid,chinaMagnesium Chloride Hexahydratefobpricepackingmineralmiddle eastCitalopram HydrobromideAlbuterol SulfateFerrous gluconatePotassium Magnesium Sulphateagriculture gradefertilizer gradeCarbomercarbopolAgriculture FertilizersCrop chemicalsBorax DecahydrateINKABOR SACPoly Phosphoric AcidPhosphorous Derivativesagro chemicalsDicyandiamideDCDAqualityGLUCOSAMINE HYDROCHLORIDE USPN-iodosuccinimideSalbutamol Sulphateergotamine tartratevadoadrabulk drugs manufacturerdrugsnew zealandasprincopper sulphateindustrial gradeCinnarizinepharma additivesCosmetic chemicalsc.p. gradel.r. gradea.r. gradeapplicationtanker load packingADENOSINE MONOPHOSPHATEIMPORTERcholic acidPapaverine hydrochlorideChemicalsPellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbonAmbroxol Hydrochloride Hclintermediatepharma manufacturingRanitidine HclTadalafilFebantelDidecyldimethylammonium chloride (DDAC)biocidehospitalsurgeryhospital instrument cleaningsterilization in hospitals1-Tetralonekollidon 25dispersingPolyvinylpyrrolidone Polymerpolymerexcipients pharmaAshland PVP K SeriesXanthan Gumcontract manufacturingPlasdonegeneral chemicalsZircon Sandmaharashtrazn 21%zinc sulphateoxygenationagriculturefish farming chemicalssouth india peroxidemicrocrystalline celluloseCELPHEREAsahi Kasei Corporationwaterproofing chemicalsbuildsmartbs moisturezeroXylitolsugar substituteUrsodeoxycholic acidCalcium Hypophosphitepharma process chemicalswater treatmentyellow flakesSodium sulphidehalazone powderhalazone tabletMetformin HCLCholine Magnesium TrisalicylateCyclophosphamidePiroxicamFluconazoleCelecoxibAtenololDomperidone Base & MaleateCrystalline Magnesium Sulphateinorganic saltsnutrientscrop protection chemicalsPotassium Schoeniteagriculture chemicalssoil protectionChlorinated ChemicalsstarchglycolatedurgsGluconic Acidgluconatesmadhya pradeshmumbaiboron 10%AcetonitrilePraziquantel ipPraziquantel bpveterinary apiGlycereth Cocoatescarbopol 940CIT MIT Based BiocideHandwash Concentratereadymade hand washacid slurrytop importer in indiaports in indiaTHYMOLNonyl Phenol Ethoxylatedthymequaternary ammonium saltAmmonium sulphatepharmaceutical raw materialsfood additivesbicarbonate chemicalsbenzenephenolpolyurethanesinsulation application chemicalsengineering chemicalspipelines chemicalscross linker chemicalsfulvic acidfabric softnerclariant chemicalsethoxylatesmining chemicalsboiler chemicalsthermal power plants chemicalsrubber chemicalsacrylic acidchelating agentindustrial circulating cooling water systemsair-conditioner chemicalspiperidonescale inhibitorindustrial fine chemicalsaerosol cleaning chemicalscarpet cleanershydrofluorocarbonstear gas chemicalsfoaming agentbasf TINUVINLight Stabilizer For Paint TinuvinBasf TINUVIN Stock Ethylene glycol distearateglycol chemicalsfuel additivesgasoline additivesFlavor and Fragrances chemicalsaromatic chemicalsPotassium CitrateAmmonium CitrateDihydrate Ammonium CitrateSodium Dihydrogen CitrateTri-Sodium Citratemedicine gradepulp & paper industry chemicalsFOUNDRY CHEMICALSdrinking water treatmentcitrate chemicalsdiacrylatesdistribution company in indiasuper absorbentsskin lightening chemicalscupricwood preservativedisinfectant chemicalsinsecticidesfungicidesherbicidespigment intermediatesagro intermediatespharma fine chemicalsorganic intermediateschemical liquidPhotographic ChemicalsMix XYLENE IndiaSolvent Suppliers IndiaMETHYL CYANOACETATEantiseptic chemicalsMethyl cinnamateMono Ethylene GlycolPara Chloro Meta XylenolpcmxDiclofenac Sodium4’ CHLOROPROPIOPHENONE1-(4-chlorophenyl)-1-propanoneChloroquine phosphatepotassium mono persulfateAMMONIUM ACETATEntifoam, defoamer, defoamer silicone, defoaming agdefoaming agentSilicone Antifoamssilicone emulsion defoamerIsopropyl acetatepesticidesacid gas absorbentanti-rust agentsDimethylformamide dimethyl acetaldyes intermediatesurea reactionsteroids apiamineTERT-BUTYLAMINEaroma chemicalsSodium Acetate AnhydrousAldehyde C-8 Aromatic Chemicalpyridinium salts(4 To 6%) 5 Liter Sodium HypochloriteaibnazobisisobutyromethylLithium Carbonatepolyolscoating polymer basfEthyl cyanoacetateGlutaraldehyde 50%dental cleaningmedical sterilizeCoolant Glycol Liquidcoolant chemicalsCrude Glycerine LiquidUSP Glycerine Liquidethyl alcoholpharmaceutical reaction chemicalscleaning chemicalsDodecyltrimethylammonium Bromideactive pharmaceutical ingredientsazithromycinbatteriesanimalalkyl amine chemicalsdiamines chemicalsTriethylamineDiethyl D-tartratePOTASSIUM MAGNESIUM CITRATEmagnesium chemicalschromium chemicalsinterior chemicalsenamels lacquers chemicalslubricantCorrosion Inhibitorpersonal care chemicalssurface sterilizerhygiene chemicalsconditioner cosmeticCATALYSTraw materialTAIWAN IMPORTER IN INDIAcement chemicalsfood & beverages chemicalschlorideindustrial resinpolyester resinschemical raw materialsanti cancer drugsiron chemicalscp lr ar gradePOTASSIUM CHLORIDEOrtho Phenyl Phenoloppantibacterial2-Chloro 4,5-Dimethoxy 1,3,5-triazineTriethyl CitrateEthyl chloro[(4-methoxyphenyl)hydrazono]acetateDiethylene Glycol Liquiddeg-megAluminium Ammonium Sulphatealumuv protection cosmeticfatty alcohoshydrogen gasANHYDROUS HYDROGEN CHLORIDEorganic synthesischemical solutionnickel solutionlatexesantiscalant chemicalxylidine chemicalsisomeric chemicalsadhesionestersmelamine resinmoisture protection coatingsadsorbentdesiccant chemicalscoating chemicalsPolyhexanidepolyhexamethylene biguanide solutionPHMBpolyhexamethylene biguanideantimicrobialInhibited Glycol Liquidradiator coolant chemicalsHydrogen Peroxide with Silver Nitratebio chemicals4-Chlorosalicylic acidchlorine derivativesreagent chemicalsdetecting chemicalspolycarbonatesSorbitan Estersmonostearatedispersing agentsElectroplatinganiline chemicalsplastic black masterbatchcarbon masterbatchblack masterbatchmedical gradeearth chemicalsdolomiteprinting inksquaternary phosphonium saltsstabilizertoothpaste chemicalsgelling agentthickenerchiral chemicalsisocyanatesdiols chemicalssilicone processtitanate chemicalsimatinib raw materialsfrp chemicalsfrp chequered platesfrp productsfrp gratingsMethyltrioctylammonium chlorideemulsion polymerPolydiallyldimethylammonium chloridediallyldimethylammonium chloridePolyDADMACpolyetheraminesBaxxodurBenzyl tributyl ammonium chloridepharmaceutical additivessaccharinpharma probiotic chemicalslevulinate chemicalsbronopolcooling water treatmenttoys manufacturing chemicalscept chemicalsflocculanthigh pH chemicalsAA-AMPS chemicalsnanotechnology chemicalsnano powder chemicalsleather industry chemicalssulfonated chemicalsepoxyepoxy chemicalsepoxy floor coatingalcohol chemicalsMecetronium ethylsulfatehand sanitizersBarium hydroxide octahydrateInositol (Myo-Inositol)N-METHYL PYRROLIDONE4-Morpholinopiperidinesurgical cleaningCOA & MSDS chemicalspharmaceutical resinsglycinate chemicalspharma distributortablet distributorpcd pharma distributorpyrophosphate chemicalsnitrificationpranlukast intermediatesbalaji aminesbinderssealantsoftenersheptahydrate chemicalsoil chemicalsmalaria oilanti larva oilmolesservicesdesalination plant chemicalsmembrane chemicalsthiazides process chemicalsmetal chemicalsceramic chemicalsEDTA saltsPara Chloro Meta CresolpcmcantisepticchemicalFoamasterPropylene Glycol LiquidPioglitazone Hclabsorbant9-Anthracenemethanolhydroxymethyl groupDIISOPROPYLAMINEro chemicalsreverse osmosis chemicalszyme granulesLanxess bayferroxlanxess inorganic pigmentslanxess bayferrox oxidesipa hand sanitizerscopolymershomopolymersbasf polymersnitric acidhanwha corpkorea nitric acidautomobile chemicalscaprylate cosmetic chemicalscaprate group cosmetic chemicalsgnfc chemicalsph control agentantibiotic intermediatespetroleum pipeline chemicalsIP BP USP Grade Chemicals#Poly-aluminium-chlorideGACL-PACSodium CyanatePOLYSORBATE 20Acetyl Tri(2-Ethylhexyl) CitrateATEHCglycerinePine OilPhenyltrimethylammonium chlorideWhite Phenyl ConcentrateConcentratereadymade phenylrwc boosterblack phenyldata of chemicalsbarium chemicalspest control agentGlyoxalFlavor and FragrancesLiquid Diethyl Ethoxymethylene MalonatebangaloreGFL CAUSTIC SODAGUJARAT FLUOROCHEMICALSlactate chemicalschloride chemicalsorotate chemicalsremoval chemicalsdescaling agentmundra portnhava sheva portsilver testing chemicalsthiophenecashew nutscommodityguar gumlicencecast resinboai nyk pharma pvpPVA BASED FILM COATINGliquid chemicalsomeprazol drug intermediatescitral chemicalsamide chemicalsN-Propyl bromideaerospace chemicalsaviation chemicalsadhesivesDipropylene glycolchelateTETABenzisothiazolinoneDisodium Ethylenebis Dithiocarbamateplastic chemicalslactic acidVeterinary APIgel basedethanol based hand sanitizer99% Polyethylene Glycol LiquidPharmaceutical Grade Menthol Crystalanticorrosive agent chemicalscleansing chemicalsct scan chemicalsradio chemicalspathology chemicalsx-ray chemicalsaspartate chemicalsoral pharmaceuticaltextile pasteheat treatment saltsready pelletsEthylene glycolMono Ethylene Glycol Liquidmegmonoethylene-glycolPH EUR Grade pharmabiopolymershplc chemicalslocomotive steam chemicalsvaporization equipmentscrude oil evaporationOBPCPOrtho Benzyl Para ChlorophenolMonopropylene glycol USPTriethylene glycolMalathion PowderHydroxylammonium sulfatecementHPMC customizable film coatingEmulsion Stabiliserglycinestearate chemicalsethyl chemicalspolymer for paper industrythinnertoluic acidAliphatic Bromidebromide chemicalsDocusate sodiumdioctyl sodium sulfosuccinatedossdssLight Creosote OilCreosote oilCresylic CreosoteTar oilFurfuryl alcoholPoly aluminium chloride liquid 9%, 14%, 17%paracetamol powderacetate chemicalsoleo chemicalsmyristic acidcoatingsspandex fiberscoagulant chemicalsfiller plasticwetting agentsreducing agent chemicalscooling tower chemicalsindustrial water treatmentketones chemicalsapi powderanimal feed chemicalsepoxy resinlarvicide agro chemicalsdrilling fluid chemicalsreducing agentchemical manufacturerchemical intermediatesanti caking agentsfire chemicalssolar cells chemicalsbattery chemicalsev chemicalsessential oilschemical powderFood ChemicalsPharma Intermediate paraffin oilisomer chemicalsKetoconazole IP BP USPKetoconazole IP BP USP powderapi manufacturerEDTA ZincEDTA trisodiumEDTA tetrasodium saltEDTA manganeseEDTA ferricEDTA ferrousEDTA ironEDTA glycinateEDTA disodium saltEDTA copperEDTA cobaltEDTA DipotassiumEDTA Copper chelateEDTA chelated zincEDTA Calciumedta salts manufactureredta chemicalsgujarat india edta saltsBoron Citrate Chelatedmanufacturer in vadodaraBoron Citrate Chelated manufacturerAmmonium Citrate Chelatedgujarat india Ammonium Citrate ChelatedLACTULOSE SOLUTIONAtorvastatin APILidocainemanufacturer in indiacalcium chemicalspeptide chemicalslaundry chemicalshair formulation chemicalspharma apiapi intermediate
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
View Details
Lidocaine Base HCL IP BP
Lidocaine Base HCL IP BP USP manufacturer, all types of Lidocaine chemicals, Lidocaine pharma api powder available.
View Details
Lidocaine Base HCL IP BP
Emerged as a reputed Material & Service provider of the industry, we are engaged in rendering qualitative Various Floor Coating Material and Services.Epoxy FlooringPU FlooringUcrate FlooringMastic FlooringHeavy Screed Flooring3D FlooringMettalic FlooringDesigner FlooringMicro Chipping FlooringPolyUratha FlooringConductive / Anti Static FlooringHybrid Flooring
View Details
Floor and Wall Coating

INR 57 INR 58
You Save: INR 1 (1.72%)

2-Chloro-5-Nitrobenzoic Acid raw materials, powder manufacturer of nitrobenzoic acid
View Details
2-Chloro-5-Nitrobenzoic

INR 2480 INR 2500
You Save: INR 20 (0.8%)

Offering high quality Sodium Selenite Pentahydrate BP, pharma grade Sodium Selenite Pentahydrate BP, feed industry chemicals,medicinal grade Sodium Selenite Pentahydrate BP
View Details
Sodium Selenite Pentahyd

INR 1660 INR 1662
You Save: INR 2 (0.12%)

TUNGSTATE CHEMICALS MANUFACTURER, TUNGSTATE PIGMENTS, TUNGSTATE SODIUM CHEMICALS, Tungsten Carbide PowderTungsten PowderPotassium TungstateSodium Tungstate HydrateTungstic AcidPhosphotungstic Acid HydrateSodium MetatungstateTungsten TrioxideSilicotungstic AcidTungsten DisulphideAmmonium Para TungstateAmmonium Meta TungstateCadmium tungstateCobalt TungstateCesium TungstateMagnesium TungstateBismuth Tungsten OxideManganese TungstateBarium Tungstate
View Details
TUNGSTATE CHEMICALS MANU

INR 335 INR 390
You Save: INR 55 (14.1%)

Ethyl chemicals, acetate chemicals, bromide chemicalsEthyl acetateEthyl BromideEthyl cellosolveEthyl CelluloseEthyl Chlorideethyl chloroacetateEthyl Cyano Acetate (ECA)Ethyl Cyano Acrylate
View Details
ETHYL CHEMICALS

INR 253 INR 255
You Save: INR 2 (0.78%)

META CHLOROANILINE 3-CHLOROANILINE, pharma chloroaniline intermediates, chloroaniline chemicals manufacturer
View Details
META CHLOROANILINE 3-CHL

INR 1248 INR 1250
You Save: INR 2 (0.16%)

medicinal CHROMIUM PICOLINATE USP, pharma grade CHROMIUM PICOLINATE USP, high quality CHROMIUM PICOLINATE USP, Chromium picolinate has been used in alternative medicine to treat chromium deficiency, as an aid to controlling blood sugar in people with diabetes or prediabetes, to lower cholesterol, and as a weight-loss supplement.
View Details
CHROMIUM PICOLINATE USP

INR 2278 INR 2280
You Save: INR 2 (0.09%)

pharma grade EDETATE DISODIUM DIHYDRATE IP BP USP, animal feed EDETATE DISODIUM DIHYDRATE IP BP, feed EDETATE DISODIUM DIHYDRATE USP, cosmetic EDETATE DISODIUM DIHYDRATE,
View Details
EDETATE DISODIUM DIHYDRA

INR 188 INR 190
You Save: INR 2 (1.05%)

CITRIC ACID ANHYDROUS IP BP USP, pharma grade CITRIC ACID ANHYDROUS IP BP USP, food grade CITRIC ACID ANHYDROUS IP BP USP, fine chemicals CITRIC ACID ANHYDROUS IP BP USP,
View Details
CITRIC ACID ANHYDROUS IP

INR 64 INR 66
You Save: INR 2 (3.03%)

1,6-Hexanediol Diacrylate,Allyl Methacrylate,Ethylene Glycol Dimethylacrylate,Glycidyl Methacrylate,Trimethylolpropane Triacrylate,Trimethylolpropane Trimethacrylate, Crosslinkers Chemicals
View Details
Crosslinkers Chemicals

INR 200 INR 220
You Save: INR 20 (9.09%)

MONOMETHYLAMINE, METHANAMINE imported ready stock available,
View Details
MONOMETHYLAMINE (METHANA

INR 108 INR 110
You Save: INR 2 (1.82%)

Importer, contract manufacturer & supplier of aroma aromatic chemicals, flavor & fragrance chemicals in Vadodara, Gujarat, India. Acetal E (Verotyl)AcetoinAganile (Peonile)Aldehyde C11 (Undecylenic Aldehyde)Allyl CaproateAllyl Cyclo Hexyl PropionateAllyl HaptoateAlpha DamasconeAlpha Pinene 95%Ambergris Ketone (Iso E Super)Ambermor Dl (Ambrox Dl)Ambermor Flakes (Ambroxan)Ambermor Ketal (Amber Ketal)AmbretolideAmbrocenide PureAmyris OilAndreneAnethole 99%Angelica Seed OilAnisyl AcetoneAquamor (Calone)Armoise OilAtralone (Evernyl)AurantilolBalsam PeruBenzophenoneBergamot OilBeta DamasconeBeta PineneBezyl SalicylateBuchu Leaf OilButyl Butyryl LactacteCaraway OilCaryophyllene AcetateCaryophyllene OxideCashmeranCat KetoneCedarwood Oil TexasCedrol CrystalsCedryl Acetate CrystalsCedryl Acetate LiquidCedryl Methyl EtherCelestolideChamomile Oil Blue / RomanCinnamic AcidCinnamyl AcetateCinnamyl FormateCis - 3 - Hexenyl 2 Methyl ButyrateCis - 3 - Hexenyl AcetateCis - 3 - Hexenyl BenzoateCis - 3 - Hexenyl ButyrateCis - 3 - Hexenyl CaproateCis - 3 - Hexenyl Iso ButyrateCis - 3 - Hexenyl Iso ValerateCis - 3 - Hexenyl Phenylâ Â AcetateCis - 3 - Hexenyl PropionateCis - 3 - Hexenyl TiglateCis 6 NonenalCis 6 NonenolCis JasmoneCitralCitronellolCitronellyl AcetateCitronellyl ButyrateCitronellyl CaproateCitronellyl FormateCitronellyl Iso ButyrateCitronellyl Iso ValerateCitronellyl PropionateCitronellyl TiglateClary Sage OilClove Leaf OilClove Oil PgClove Oil Rectified 85%Clove TerpenesCoriander Seed OilCuminic AldehydeCyclo Hexyl SalicylateD LimoneneD.m.b.c.D.m.b.c.a.D.m.b.c.b.DamascenoneDelta DamasconeDelta DecalactoneDelta DodecalactoneDelta HexalactoneDelta NonalactoneDelta OctalactoneDelta TetradecalactoneDelta UndecalactoneDi Hydro Ionone BetaDi Hydro JasmoneDi Hydro TerpeniolDi Hydro Terpinyl AcetateDi Methyl Phenyl EthylDi MetolDi Phenyl MethaneDiacetylDifurfuryl DisulphideDihydro Myrcenyl AcetateDmo AcetateDynamor (Dynascone Pure)Elemi OilEthyl 2 Methyl ButyrateEthyl ButyrateEthyl CinnamateEthyl MaltolEthyl Phenyl AcetateEthyl SafranateEthyl VanillinEthylene Brassylate (Musk - T)Eucalyptol Pure (99%)EugenolEugenyl AcetateFdl - 40Fenchyl AcetateFenchyl Alcohol (Fenchol)FructoneFuranone (Furaneol)Furfuryl AlcoholFurfuryl MercaptanGalaxolide 50% DepGalaxolide 50% IpmGalaxolide PureGalbanum OilGamma DecalactoneGamma DodecalactoneGamma HeptalactoneGamma HexalactoneGamma NonalactoneGamma OctalactoneGamma Undecalactone (C-14)Gamma ValerolactoneGarlic OilGeraniol 60Geraniol 98Geranium OilGeranyl Acetateâ (Min 98% / 2 Peak)Geranyl ButyrateGeranyl FormateGeranyl Iso ButyrateGeranyl Iso ValerateGeranyl PropionateGeranyl TiglateGreen Leaf (Trans 3 Hexenol)Guaiacwood OilGuaiyl AcetateGurjun Balsam Oil Dark / LightHeliogan (Helional)HelionalHexyl AcetateHexyl ButyrateHexyl Iso ButyrateHexyl SalicylateHydroxyambranIso Amyl AcetateIso Amyl ButyrateIso Bornyl AcetateIso Butyric AcidIso Cyclo CitralIso Valeric AcidIso Amyl PropionateIso Amyl SalicylateJasmorangeKaramorKovyral (Lyral)L BacdanolL Carvone 99%Lavender AbsoluteLavender OilLavendin Abrillis OilLavendin AbsoluteLavendin Grosso OilLemon OilLemon Oil (4% Citral)LinaloolLinalool OxideLinalyl AcetateLinlan Alcohol (Majantol)M.c.k. 80% (Methyl Cedryl Ketone)MaltolMandarin Oil GreenMandarin Oil RedManzanateMaple LactoneMelomorMenthyl LactateMethionalMethoxy Phenal (Canthoxal)Methyl Amyl KetoneMethyl CinnamateMethyl Dihydro Jasmonate (Hc30 / Hc70)Methyl Dihydro Jasmonate (Hedione)Methyl PamplemousseMethyl Phenyl AcetateMilk LactoneMuscemore (Muscenone)MusconeMuscosandrol (Ebanol)Musk AmbretteMusk C - 14Musk KetoneMusk XylolMyrac Aldehyde (Myral)Myrcene 80N Butyric AcidN HexanolNerylacetateNoot Ketone CrystalsNopyl AcetateNutmeg OilOakmoss AbsoluteOcimeneOctyl AcetateOnion OilOrange CarbonylOrange OilOrange Oil BitterPadmaPara Cresyl AcetatePatchouli OilPatchouli Oil (Rco)Patchouli Oil (Standard)Patchouli Oil Iron FreePetit Grain OilPhenyl Ethyl AcetatePhenyl Ethyl BenzoatePhenyl Ethyl ButyratePhenyl Ethyl FormatePhenyl Ethyl Iso ButyratePhenyl Ethyl TiglatePhenyl HexanolPoivrol (Mahagonate)Precyclemone BPropenyl GuaetholPropionic AcidPyranolRaspberry KetoneResinoid BenzoinResorcinol Dimethyl EtherRhodinol (Ex Geranium)Rhodinol (Synthetic)Rhodinyl AcetateRomoxyde (Cedroxyde)RosalvaRose Oxide 70:30 (Inactive)Rose Oxide 90:10 (High Cis)Rose Petal Acetate (Roseate)Rosemary OilSage OilSandal BoosterSandelorSandenol (Icch)SclareolSclareolideStrawberryiffStyrax OilSulfurolSulfuryl AcetateTerpenyl AcetateTerpinen-4-olTetra Hydro Geraniol (Dmo)Tetrahydro LinaloolThiomenthoneTonalideTrans 3 Hexenyl AcetateTrans 3 Hexenyl BenzoateTrans-2-hexenalTrans-2-hexenolTrigustral (Triplal)Triplal (Hivertal, Ligustral)TropathianeValenceneVeratraldehydeVetiver Oil (Haiti)Vetiveryl Acetate (Eco)Vetiveryl Acetate (Ex Haiti)Whisky LactoneWoodamberYlang Oil ExtraYlang Oil IiiZingerone
View Details
AROMATIC FLAVOR & FRAGRA

INR 369 INR 380
You Save: INR 11 (2.89%)

Importer & supplier of aromatic intermediates, aroma chemicals, flavor chemicals, fragrance chemicals in India.2-Acetyl Pyrazine2 Methyl Butyric Acid2 Methyl Undecanal2 Pentyl Cyclo Pentanone (Delphone)2-3 Dimethyl Pyrazine2-3-5 Trimethyl Pyrazine2-3-5-6 - Tetra Methyl Pyrazine2-acetyl Furan2-ethyl Pyrazine2-ethyl-3-5-dimethyl Pyrazine2-iso Propyl- 4-methyl Thiazole2-isobutyl Methoxy Pyrazine2-methoxy-3- Methyl Pyrazine2-methoxy-4-vinylphenol2-methyl Pyrazine2-methyl Thio-(3 Or 5)-methyl Pyrazine2-sec Butty-3-methoxy Pyrazine3-mercaptohexanol4 Acetoxy Furanone4 Vinylguaiacol4-methyl-5-Vinayl Thiazole4-methyl-5-vinylthiazole5-methyl Furfural6-methylcoumarin
View Details
AROMATIC INTERMEDIATES

INR 248 INR 250
You Save: INR 2 (0.8%)

Manufacturer exporter & supplier of carbonate & bicarbonate IP BP USP pharma grade chemicals.Pharma comply carbonate chemicals, Pharma grade bicarbonate chemicals,Calcium Carbonate IP/BP/USP,Sodium Carbonate Anhydrous IP/BP/USP NF,Sodium Carbonate Monohydrate IP/BP/USP NF,Potassium Carbonate,Zinc Carbonate USP,Sodium Bicarbonate IP/BP/USP,
View Details
CARBONATES & BICARBONATE

INR 78 INR 80
You Save: INR 2 (2.5%)

This medication is an iron supplement used to treat or prevent low blood levels of iron (such as those caused by anemia or pregnancy). Iron is an important mineral that the body needs to produce red blood cells and keep you in good health.
View Details
FERROUS SULPHATE DRIED I

INR 26 INR 28
You Save: INR 2 (7.14%)

Para tertiary butylphenol formaldehyde resin also known as p-tert-butylphenol-formaldehyde resin (PTBP-FR) or 4-(1,1-dimethylethyl) phenol (PTBP Formaldehyde) is a phenol-formaldehyde resin found in commercial adhesives, and in particular in adhesives used to bond leather and rubber.
View Details
Para tertiary butylpheno

INR 230 INR 250
You Save: INR 20 (8%)

Propyl acetate, also known as propyl ethanoate, is a chemical compound used as a solvent and an example of an ester. This clear, colorless liquid is known by its characteristic odor of pears. Due to this fact, it is commonly used in fragrances and as a flavor additive.
View Details
N PROPYL ACETATE

INR 123

N-Bromosuccinimide is a chemical reagent used in electrophilic additions and radical substitution reactions in synthetic organic chemistry. In Wohl-Ziegler reaction, it is involved in allylic and benzylic bromination reaction. It is also used in the alfa-bromination of carbonyl derivatives.
View Details
N-Bromosuccinimide

INR 2800 INR 2832
You Save: INR 32 (1.13%)

Offering high quality hand sanitizers, 5 liters packing, IPA - Isopropyl Alcohol & Ethanol - Ethyl Alcohol. Contact for bulk and small packing price.
View Details
5 Liters Hand Sanitizer

INR 502 INR 520
You Save: INR 18 (3.46%)

In addition to carbonated diet drinks, saccharin is used to sweeten low-calorie candies, jams, jellies, and cookies. It's also used in many medicines. Saccharin can be used similarly to table sugar to sprinkle onto food, such as cereal or fruit, or used as a sugar substitute in coffee or when baking.
View Details
SODIUM SACCHARIN
TERPINYL BUTYRATE available in stock
View Details
TERPINYL BUTYRATE

INR 350

It is used commercially as a component in perfumes and in flavor production for the food industry. It is usually produced by hydroformylation of heptene and the dehydrogenation of 1-octanol. Octanal can also be referred to as caprylic aldehyde or C8 aldehyde.
View Details
Aldehyde C-8 Aromatic C

INR 1600

Agrochemical Category:Fungicide, HerbicideIndustry Uses:Adhesives and sealant chemicals Corrosion inhibitors and anti-scaling agents
View Details
Disodium Ethylenebis Dit
Acid slurry manufacturer in drums & carboys, vadodara
View Details
Acid slurry

INR 85

p-Divinylbenzene(DVB) is a cross-linking agent, which is used in a variety of polymeric processes such as copolymerization of styrene to improve the thermo-mechanical properties of the composite.
View Details
p-Divinylbenzene(DVB)
High quality cosmetic chemicals Tetrasodium glutamate diacetate available in stock
View Details
Tetrasodium glutamate di

INR 75 INR 80
You Save: INR 5 (6.25%)

Offering high quality paracetamol powder, paracetamol BP USP PH EUR grade
View Details
Paracetamol Powder
We are dealing in all types of polyelectrolyte Anionic, Cationic, Nonionic. They are thus often used as thickeners, emulsifiers, conditioners, clarifying agents, and even drag reducers. They are used in water treatment and for oil recovery.
View Details
Polyelectrolyte polyacry

INR 143 INR 145
You Save: INR 2 (1.38%)

Manufacturer, exporters & suppliers of quaternary ammonium & phosphonium compounds in India. Alkyl Trimethyl Ammonium BromideBenzalkonium Chloride 50% & 80%Benzalkonium Chloride PowderBenzyl Tributyl Ammonium ChlorideBenzyl Triethyl Ammonium Chloride 50%Benzyl Trimethyl Ammonium BromideBenzyl Trimethyl Ammonium ChlorideBenzyl Trimethyl Ammonium Dichloro IodideBenzyl Triphenyl Phosphonium ChlorideButyl Triethyl Ammonium BromideCetalkonium BromideCetalkonium ChlorideCetrimide 40% Strong SolutionCetrimide Ip/bp/usp/epCetrimide Powder BP / IPCetyl Dimethyl Amine Oxide 30%Cetyl Dimethyl Benzyl Ammonium BromideCetyl Dimethyl Benzyl Ammonium ChlorideCetyl Dimethyl Benzyl Ammonium ChlorideCetyl Pyridine Chloride CpcCetyl Pyridinium ChlorideCetyl Trimethyl Ammonium BromideCetyl Trimethyl Ammonium Bromide PowderCetyl Trimethyl Ammonium ChlorideCetyl Trimethyl Ammonium Chloride 30%Cetyl Trimethyl Ammonium Chloride 50%Cetyl Trimethyl Ammonium Chloride PowderCetyl Trimethyl Ammonium Ptoluene SulfonateCetyl Trimethyl Ammonium TosylateCetylpyridinium ChlorideChlorhexidine Acetate BP/EP/USPChlorhexidine BaseChlorhexidine Gluconate 20% Solution BP/EP/USPChlorhexidine Hydrochloride BP/EP/USPDidecyl Dimethyl Ammonium Bromide 65%Didecyl Dimethyl Ammonium Chloride 80%Dodecyl Trimethyl Ammonium Bromide PowderDodecyl Trimethyl Ammonium ChlorideDodecyl Trimethyl Ammonium Chloride PowderEthyl Hexadecyl Dimethyl Ammonium BromideEthyl Triphenyl Phosphonium BromideEthyl Triphenyl Phosphonium ChlorideHexadectyl Trimethyl Ammonium ChlorideHexadecyl Trimethyl Ammonium BromideLauryl Dimethyl Amine Oxide 30%Lauryl Trimethyl Ammonium ChlorideMethyl Paraben BPMethyl Tributyl Ammonium BromideMethyl Tributyl Ammonium ChlorideMethyl Tributyl Ammonium ChlorideMethyl Tricapryl Ammonium ChlorideMethyl Trimethyl Ammonium ChlorideMethyl Trioctyl Ammonium ChlorideMethyl Triphenyl Phosphonium BromideMethyl Triphenyl Phosphonium ChlorideMyristyl Dimethyl Amine Oxide 30%Myristyl Dimethyl Benzyl Ammonium ChlorideMyristyl Trimethyl Ammonium BromideMyristyl Trimethyl Ammonium Bromide PowderMyristyl Trimethyl Ammonium Chloride PowderPhenyl Trimethyl Ammonium ChloridePhenyl Trimethyl Ammonium TribromidePovidone Iodine 10% Solution USPPovidone Iodine Powder USPPropyl Paraben BPSodium Methyl Paraben BPSodium Propyl Paraben BPStrong Cetrimide 40% Solution w/v BPTertiary Butyl HydroquinoneTetra Butyl Ammonium BromideTetra Butyl Ammonium ChlorideTetra Butyl Ammonium Fluoride 1m In ThfTetra Butyl Ammonium Fluoride TrihydrateTetra Butyl Ammonium Hydrogen SulphateTetra Butyl Ammonium HydroxideTetra Butyl Ammonium IodideTetra Butyl Ammonium PerchlorateTetra Butyl Ammonium Ptoluene SulfonateTetra Butyl Ammonium TosylateTetra Ethyl Ammonium BromideTetra Ethyl Ammonium IodideTetra Ethyl Ammonium Ptoluene SulfonateTetra Ethyl Ammonium TosylateTetra Methyl Ammonium BromideTetra Methyl Ammonium ChlorideTetra Methyl Ammonium ChlorideTetra Methyl Ammonium HydroxideTetra Methyl Ammonium IodideTetra Octyl Ammonium BromideTetra Propyl Ammonium BromideTetra Propyl Ammonium Bromide (50% Aqueous Solution)Tetra Propyl Ammonium IodideTetradecyl Trimethyl Ammonium BromideTributyl Ammonium Chloride
View Details
EUROPE & AFRICA QUATERNA

INR 425 INR 445
You Save: INR 20 (4.49%)

HEDP is an organophosphoric acid corrosion inhibitor. It can chelate with Fe, Cu, and Zn ions to form stable chelating compounds.It can dissolve the oxidized materials on these metals’ surfaces. HEDP shows excellent scale and corrosion inhibition effects under temperature 250℃. HEDP has good chemical stability under high pH value, hard to be hydrolyzed, and hard to be decomposed under ordinary light and heat conditions. Its acid/alkali and chlorine oxidation tolerance are better than that of other organophosphoric acids (salt). HEDP can react with metal ions in water system to form hexa-element chelating complex, with calcium ion in particular. Therefore, HEDP has good antiscale and visible threshold effects. When built together with other water treatment chemicals, it shows good synergistic effects.
View Details
1-Hydroxy Ethylidene-1,1

INR 92 INR 95
You Save: INR 3 (3.16%)

Available in stock, quaternary ammonium bromide compoundsDidecyl Dimethyl Ammonium Bromide 65%Myristyl Trimethyl Ammonium Bromide PowderTetra Ethyl Ammonium BromideDodecyl Trimethyl Ammonium Bromide PowderTetra Butyl Ammonium BromideAlkyl Trimethyl Ammonium BromideEthyl Hexadecyl Dimethyl Ammonium BromideTetra Propyl Ammonium BromideCetyl Trimethyl Ammonium Bromide Powder
View Details
QUATERNARY AMMONIUM BROM

INR 260 INR 280
You Save: INR 20 (7.14%)

Benzyltriethylammonium chloride is a lipophilic phase-transfer catalyst that can be used in phase-transfer catalysis (PTC) to catalyze polycondensation reactions to form high molecular weight polymers under bi-phasic conditions.
View Details
Benzyltriethylammonium c

INR 365 INR 385
You Save: INR 20 (5.19%)

Best quality White Phenyl Concentrate ready to use compound available at lowest price. Ready to use phenyl Concentrate.
View Details
White Phenyl Concentrate
Ethylene glycol distearate (or EthyleneGlycol Distearate - EGDS) is a product commonly used in cosmetic formulations, as an agent providing a certain pearlscence and / or thickening and / or stabilizing agent. ... The crystals may preferably be included in a fluid concentrated ingredient to be formulated.
View Details
Ethylene glycol disteara

INR 86 INR 87
You Save: INR 1 (1.15%)

We offer high and fine quality Crude Glycerine Liquid to our most reliable customers which are situated all round the nation.
View Details
Crude Glycerine Liquid

INR 34 INR 37
You Save: INR 3 (8.11%)

Offer to sell high quality Lithium Carbonate chemicals
View Details
Lithium Carbonate
BEST PRICE FOR POLYSORBATE 20, PHARMACEUTICAL EXCIPIENTS, CREAM MANUFACTURING
View Details
POLYSORBATE 20
Defoamers surpress and destroy foam and its negative effects prior to and during application of a coating. By removing or inhibiting air bubbles they are important process aids throughout the paint production, as well as the application process. Paint manufacturers benefit from foam-free production processes by reaching their desired results much quicker and do not have to worry about additional negative side effects, for example, inaccurate filling of containers due to entrapped air. During application the build up of foam has to be prevented to ensure an optimum paint surface without any residue of bubbles or other surface defects.Offering : Silicon based Defoamers, Water based Defoamers, Polymer Based Defoamers, Oil-Based Defoamers, Emulsion DefoamersFoamaster® NO 2306Foamaster® MO 2134Foamaster® MO 2150 Foamaster® NO 2335 Foamaster® MO 2121Foamaster® AP Foamaster® DF 201Foamaster® PD 1 Foamaster® PL Foamaster® RDFoamaster® 75 Foamaster® 714 Foamaster® 60 Foamaster® WO 2323 Foamaster® WBA Foamaster® TCX Foamaster® NXZ Foamaster® MO NXZ Foamaster® MO NDW Foamaster® MO 2134 Foamaster® 8034 E
View Details
Foamaster Series Additiv

INR 530 INR 550
You Save: INR 20 (3.64%)

Desalination, Disinfection, Foam Control, Metals Removal, Nutrient Removal 5-Chloro-2-Methyl-4-Isothiazolin Ones,2-Methyl-4-Isothiazolin Ones
View Details
CIT MIT Based Biocide
We have successfully been engaged in providing excellent quality Ammonium Acetate. At our well-advanced labs, the offered acetate is processed under suitable conditions with the use of best grade chemicals by our dexterous team of professionals. The provided chemical is effective to be used as an important food additive. Also, it is used with acetic acid for the preparation of buffer solution. Additionally, our clients can purchase this Ammonium Acetate at reasonable prices from us.
View Details
AMMONIUM ACETATE

INR 75 INR 80
You Save: INR 5 (6.25%)

We are instrumental in formulating and processing a wide range of high quality Potassium mono persulfate. Our organization is counted amongst the reputed names of the market engaged in processing, trading and wholesaling different types of chemicals that are formulated using quality ingredients. These chemicals are highly effective and accurately proportion of ingredients is added to to the composition, so as to add longer shelf life and longer usability. Clients across different industries avail our products. We can offer these in different specifications like grades, volatility and dilutions. Minimum Order Quantity 25 KgForm PowderSize/Dimension CustomizePackaging Size 25 kgs HDPE DRUMGrade High leavel disinfectantBrand Usage/Application High level disinfectantPurity Pure
View Details
Potassium mono persulfat

INR 982 INR 1100
You Save: INR 118 (10.73%)

Ethyl cyanoacetate is an organic compound that contains a carboxylate ester and a nitrile. It is a colourless liquid with a pleasant odor. This material is useful as a starting material for synthesis due to its variety of functional groups and chemical reactivity.
View Details
Ethyl cyanoacetate
We are a leading exporter, distributor, wholesaler, trader, retailer, importer & supplier of an exclusive range of Methyl Cyanoacetate.
View Details
METHYL CYANOACETATE
Carbopol 940 polymerCarbopol 940 polymer is a white powder, crosslinked polyacrylic acid polymer. It is an extremely efficient rheology modifier capable of providing high viscosity and forms sparkling clear gels or hydro-alcoholic gels and creams. Its short flow, non-drip properties are ideal for applications such as clear gels, hydroalcholic gels, and creams.Features/BenefitsCompatible with other materials used in styling gelsHigh viscosity builder and stabilizerProvides clarity and a high suspending ability in hair gelsProvides high clarityShort flow rheology characteristics
View Details
Carbopol 940 polymer
Glycereth Cocoates used in Bath and shower products Hair care Men's grooming products Skin care
View Details
Glycereth Cocoates
Petroleum jelly, petrolatum, white petrolatum or soft paraffin, CAS number , is a semi-solid mixture of hydrocarbons (with carbon numbers mainly higher than originally promoted as a topical ointment for its healing properties.
View Details
White Petroleum Jelly
We are one of the leading 3-Ethynylaniline supplier, manufacturer and exporter in India. Our this product is developed in an automatic manufacturing plant using the best quality raw materials. Further, this product is made as per international norms and standards and tested on various quality parameters. Our products are highly appreciated and demanded in various business segments due to their best quality and reliability. We offer this chemical in various packing options to our customers as per their requirement at best competitive prices.
View Details
3-Ethynylaniline
Methanesulfonic anhydride Trifluoro Methane Sulfonic AnhydrideAPPEARANCE: colorless to light yellow liquid, strong corrosive, strong hygroscopic, strong volatile.USAGE: widely used as intermediate in medicine and chemical industry.
View Details
Methanesulfonic anhydrid
Offering high quality Ursodeoxycholic acid, contract manufacturer in India. Available in small and bulk packing.Ursodeoxycholic acid (UDCA), also known as ursodiol is one of the secondary bile acids, which are metabolic byproducts of intestinal bacteria.
View Details
Ursodeoxycholic Acid
Salbutamol Sulphate is used to treat wheezing and shortness of breath caused by breathing problems (such as asthma, chronic obstructive pulmonary disease). Albuterol - Salbutamol Sulphate belongs to a class of drugs known as bronchodilators. It works in the airways by opening breathing passages and relaxing muscles. Controlling symptoms of breathing problems can decrease time lost from work or school. We are a leading manufacturer and supplier of Salbutamol Sulphate.
View Details
Salbutamol Sulphate

INR 6750 INR 7000
You Save: INR 250 (3.57%)

Chlorpheniramine Maleate suppliers, Manufacturer imported available in stock
View Details
Chlorpheniramine Maleate
Activated Carbon is a porus form of carbon which is manufactured from various carbonaceous raw materials like Pine wood, Coconut shell, Coal, Eucalyptus, Peat, Saw dust, Rice husk, Lignite etc. It is preapered through Carbonisation & Activation of Organic substance. During Carbonisation most of non-carbon elements, Hydrogen, Oxygen are first removed in Gaseous form & it develops the internal pores and then after it is Activated through Chemical Activation or Steam Activation.In Activation process, it increases the numbers & dimensions of Pores & hence it has large internal surface area.Applications of Activated carbon :Air stripper off gasIts purifies carbon dioxideUsed to purity nitrogen in various plastics manufacturing processUsed as a catalyst support and protectorUsed in gasoline vapour recoveryUsed in recovery of various useful solvents which are emitted out as waste gases in various industriesIn gassifiers to purify the gasesTo remove odors from the air and gasesIt is used in effluent treatment plant to reduce BOD/COD/Color from industrial water.It removes chlorine and organic impurities from drinking water in the last stage filtration in our common house hold filters.It is used as adsorbent of poisonous gases in gas masks for industrial as well as defense purpose.To adsorb moisture from compressed air in paint shopsTo dechlorinate waters in swimming pool and soft drink plantTo remove oil from hot condensateTop quality granular activated carbons are used in the process of gold recovery in which the molten one is passed over a bed of activated carbon where the gold is adsorbed on the carbon and recovered.Used to manufacture catalystRemove of dissolve organic impuritiesBreweries and distilleriesCatalyst carrier in petroleum refineriesIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationIt is used in decolorisation of liquids having impurities with larger pore size i.e sugar solutions, glucose, dextrose,lactose & other starch sugar solutionUsed in decolorisation of vegetable oils and fats and herbal productsIt is mainly used in the decolorisation of active pharmaceuticals ingredientsDecolorisation of plasticizers, drug intermediates, dyes & dye intermediates, food color, glycerin and fine chemicalsUsed also as drug in capsules and tablet forms for stomach ailments and applicationsUsed to purify intravenous fluid & InjectionsUsed by the pesticides and insecticides industry for decolorisationAvailable Grades :Pellets Activated CarbonGranular Activated carbonPowder Activated CarbonChemically Activated CarbonSteam Activated carbonWash Activated carbon
View Details
Activated Carbon
Asbestos Powder that we manufacturer is best available quality that anyone can get in India. Our major Product Market is Bharuch, Ankleshwar, Surat, Vadodara, Gujarat , India.. Please Call for best price.We are identified as one of the leading manufacturers, suppliers, wholesalers and exporters of premium quality Asbestos Powder. To provide finest quality, this powder is processed using high quality ingredients that are sourced from certified vendors of the market. We thoroughly check this powder on various parameters like shelf life and precise composition.Features:PurityLonger shelf lifePrecise composition
View Details
ASBESTOS POWDER
We are Best quality of Iron Ore Manufacturer and supplier. We are based on Vadodara, our main business in India is Gujarat and Bharuch, Ankleshwar, Surat, Vadodara.Product Description:Backed by rich industry-experience, we are engrossed in offering Iron Ore.Specification:Ores are rocks from which metallic iron can be economically extractedThese rocks are usually found in the form of hematite (Fe2O3) or magnetite (Fe3O4)Available in different packaging options Features:PurityLonger shelf lifeAccurate compositionApplication of Iron Ore : Welding Electrodes, Chemical Industries
View Details
IRON ORE
Features:BASF MasterTile 25 is a grey cementitious powder containing performance enhancing polymers and other specialty additives.This versatile, easy-to handle,cement-based adhesive is perfect for fixing ceramic tiles, quarry tiles and similar materials.It provides strong adhesion to cement/sand screeds,to in-situ/pre-cast and aerated concrete, and brickwork.Recommended uses:New tiling in internal areas & floors in externalCeramics TilesVitrified tiles only for Flooring applicationShowers & wet processing areasLaboratories, hospitals, canteens, etcTiling corridors, pavements and roofsCoverage:25kg bag mixed with 4.5 L of water yields 14 litres of mixed adhesive.Each bag of 25 Kg is sufficient for 4.5 ~ 5 m2 of the minimum 3mm application on a flat & smooth surface.
View Details
Mastertile 25 Grey

INR 469 INR 475
You Save: INR 6 (1.26%)

Non-shrink, cementitious grout for use in general civil engineering worksBASF MasterFlow 718 is a ready to use, non-shrink, natural aggregate cementitious grout for use in general civil engineering works.MasterFlow 718 provides extended working life and high early and ultimate strengths.RECOMMENDED USESMasterFlow 718 is recommended for:• stanchion baseplates and columns;• prefabricated concrete panels and beams;• bridge bearing plates;• anchor bolts and bars;• underpinning;• patch repair works.FEATURES AND BENEFITS• High strength - provides good early and ultimatestrengths which ensure quick return to serviceand long term durability• Non shrink - Hardens free of bleeding,settlement and drying shrinkage when placed atflowable consistency• Flowable consistency - Ensures complete fillingof even intricate voids often without the need forpumping and strapping• Ample working time - remains placeable – up to1 hour - even at high ambient temperatures• Dense, impermeable grout - Provides a goodwatertight seal• Economical - Greater volumes of grout can bemixed and handled with less labour.• Easy to use - requires no special mixingequipment, it can be mixed in a pail using a groutstirrer.• No added chloride – Does not add to chlorideload on structure• Provides complete non shrink performance-When tested in accordance with simulatedBedplate Technique.• Versatile- Can be placed from flowable totrowelable consistency
View Details
MasterFlow 718

INR 440 INR 450
You Save: INR 10 (2.22%)

Xylitol is used as a food additive and sugar substitute. Replacing sugar by xylitol in food products may promote better dental health. Sugar substitute.
View Details
Xylitol
Sodium trimetaphosphate available in industrial and commercial grade It is a colourless solid that finds specialised applications in food and construction industries.
View Details
Sodium trimetaphosphate

INR 465 INR 475
You Save: INR 10 (2.11%)

Pharma Use Papaverine hydrochloride Crystalline solid grade used in opium alkaloid antispasmodic drug, used primarily in the treatment of visceral spasm and vasospasm (especially those involving the intestines, heart, or brain), and occasionally in the treatment of erectile dysfunction. It is used in the treatment of acute mesenteric ischemia. While it is found in the opium poppy, papaverine differs in both structure and pharmacological action from the analgesic (morphine-related) opium alkaloids (opiates).
View Details
Papaverine hydrochloride
Methylene Chloride (or dichloromethane) is a colourless volatile liquid with a sweet smell. It is extensively used as a chemical solvent. It is insoluble in water but miscible with organic solvents.Methylene Chloride is synthetically produced by reacting methyl chloride or methane with Chlorine gas at 400-5000C. Methane and methyl chloride undergo a series of chain reaction and yield chlorinated products progressively.Methylene Chloride (or Dichloromethane) volatility and its ability to dissolve with numerous organic compounds make it a useful organic solvent for many chemical processes. However, methylene chloride’s ill effect on health has forced the scientists to look for its alternatives.The applications of methylene chloride are: Major use in Pharmaceutical industry Manufacturing of Polycarbonates, Phenolics, Rayon yarn. Solvent for Cellulose Acetates, Photo-resist, Tablet film coatings. Paint and Grease Removing Agent. Fire-Fighting Agent. Extractant for Edible fats, Cocoa, Butter and Essences. Adhesives for Polymethyl Methacrylate. Aerosol Propellant, Refrigerant. Chemical Reaction Media. Low-temperature heat-transfer medium.
View Details
Methylene Dichloride

INR 62 INR 65
You Save: INR 3 (4.62%)

Pat Impex is a reputed and leading manufacturer, supplier & exporter of Ferric Alum, Non Ferric Alum, Ammonia Alum & Potash Alum based at Vadodara, Gujarat, India.Alum is essentially aluminium sulphate with empirical formula Al2 (SO4)3.18HO. It is of two types (i) Ferric and (ii) Non Ferric. Ferric alum is a less pure form of aluminum sulphate. It is used in lower grades of paper for loading and sizing purposes. Ferric alum uses bauxite as the raw material. The raw material is cooked with sulphuric acid under suitable conditions. The resultant product is sold in liquid form.#alum-manufacturer, #alum, #ferricalum
View Details
Ferric & Non Ferric Alum

INR 9.2 INR 12
You Save: INR 2.8 (23.33%)

N- ACETYL GLUCOSAMINE Treatment for autoimmune disease
View Details
N- ACETYL GLUCOSAMINE
It is an all-Nautral Combination used for Osteoarthritis, Rheumatoid arthritis, Fibromyalgin and Gout. It is also Food Supplement Product.
View Details
GLUCOSAMINE HYDROCHLORID
Manufacturer and supplier of pharmaceutical grade ACTIVATED CARBON BP USP IP, small and bulk packing available
View Details
ACTIVATED CARBON BP USP
Manufacturer, supplier of Borax, USP NF Ph. Eur. Grade
View Details
Borax
We leading surplus & non moving, byproduct, waste grade chemicals & pharmaceutical, apis, drugs, solvents stock buyer & seller based at Vadodara, Vapi, Ankleshwar, Mumbai, Pune, Ahmedabad, Gujarat, India since 2009. We have following surplus chemicals in stock at our Gujarat, India location.Acetic Acid Glacial/pharma/commercial - 100 MtSulpuric Acid Commercial - 200 Mt SurplusNitric Acid Commercial - 100 Mt Surplus Acid ChemicalsSoda Ash Tata/nirma - 45 Mt SurplusCitric Acid China - 30 Mt SurplusEthyl Acetate Tanker - 50 Pvc Drums;42 Kg.Toluene Pass 92 % Moisture 0.8%1 , 4 Dioaxan /pure/ Gc 99.78%/kf 0.2% / 35 Drum/Ipa Cbm Gc 99.9% /kf 12% Water White/ph Neutral/ Tanker Load /qnty 16mt/Methanol Distilled / White/d .0.80/ph Neutral/200 DrumMono Ethyl Amine 70%N Propanol Amine 30 Pvc DrumsFormic AcidToluene Recovered No Smell - 99 % Ms DrumPottasium Sulphate 99%+ 5 Mt /off Whitwhite/99%/powder Form/50 Kg PackingOliec AcidMaliec AnhydrideIso Amyl AlcohalSodium Methoxide PowderSodium Methoxide PowderSodium Methoxide PowderTetra Butyl Ammonium Bro.Tetra Butyl Ammonium Bro.2-5 Di Bromo Pyridine4-cyano PyridineIso Nicotinic AcidP0cl3Nicotinic AcidRuthenium 5% AlluminaTri Ethyl AmineZinc DustMalic AcidAmmonium Chloride2, 6 Dimethyl AnilineTitanium ButoxideActivated Carbon Acg GradeCalcium HydroxideCrotonaldehydeAceton RecoverdDenatonium SaccharideActivated CarbonOxalic AcidBromineIsonicotinic Acid (Comm-gr)Sodium SulphatePottasium Carbonate4-fluoro-2-methoxyaniline4-bromo-2, 6-difluorobenzaldehyde2-bromo-5-fluorobenzoic AcidHydroxylamine HydrochlorideBarbituric AcidAmmonium AcetateDiethyl Amino Malonate HclLithium ChloridePhosphorous OxychlorideVinyl AcetateMethane SulfonamideSodium Bis(2-methoxyethoxy)aluminium HydrideDiethyl Oxalate2-ethylbutyric AcidCopper(Ii)sulphateIsopropyl Magnesium Chloride(2m In Thf)Isopropyl Magnesium Chloride(2m In Thf)MorpholineTrifluoromethane Sulfonic AnhydrideTrifluoromethane Sulfonic AnhydrideIron(Iii)nitrate NonahydrateTin PowderSodium Tert-pentoxideIron(Metal) PowderZinc Dust PowderThioureaFormamidine AcetateHydrazine Hydrate-80%3-methyl-2-butanoneAmmonium Bi CarbonateDimethylamine Hydrochloride
View Details
Surplus Chemicals & Phar

INR 2100 INR 2200
You Save: INR 100 (4.55%)

Pat Impex Oilfield’s corrosion inhibitors are used to effectively reduce the corrosion rate of a metal exposed to that environment, thereby extending its lifetime.By nature of its adsorption on solid surfaces, the corrosion inhibitor is a surface-active agent with a unique purpose; to protect pipe rather than to change acid behavior in the formation. Corrosion inhibitors do not stop corrosion; they greatly reduce the reaction rate of acid with steel. Proper selection and application of corrosion inhibitors also reduce pitting (the tendency of acid to corrode or dissolve metal deeply in specific sites). Corrosion inhibitors are cationic and oil wetter’s. This is the mechanism by which they adsorb on a metal surface and form an oil-wet film to protect the iron from exposure to acid. Plating out and oil wetting also occur in the formation, especially on clay minerals. To compensate for this, other additives, such as surfactants and mutual solvents, are used to restore water-wetness and maximize permeability to oil.Pat Impex Oilfield performs extensive laboratory testing in combination with additives to provide data to estimate the time of protection of pipe during the course of acid exposure to tubing in an acid treatment.
View Details
Acid Corrosion Inhibitor
White to Almost Praziquantel white crystalline powder as per IP/BP/EP/USP available.We Pure Chem Pvt Ltd, an ISO 9001:2008 certified APIs and Intermediates manufacturer, supplying Key veterinary APIs like Prazequantel IP/BP/EP/USP for domestic as well as export market.We are now in a field of Veterinary APIs, to offer Key APIs like Prazequantel IP/BP/EP/USP
View Details
Praziquantel

INR 8400 INR 8500
You Save: INR 100 (1.18%)

DCDA, Dicyandiamide is a very important intermediate, DCDA, Dicyandiamide is used with other intermediate to manufacture quality products
View Details
Dicyandiamide ( DCDA )

INR 210 INR 220
You Save: INR 10 (4.55%)

DCDA, Dicyandiamide is a very important intermediate, DCDA, Dicyandiamide is used with other intermediate to manufacture quality products
View Details
Dicyandiamide ( DCDA )

INR 210 INR 220
You Save: INR 10 (4.55%)

Poly Phosphoric Acid Manufacturer, supplier & Phosphorous Derivatives are used in various applications in agrochemical products, flame retardant chemicals, plastic additives, water treatment chemicals, pharmaceuticals and dyes intermediates and many other fine chemicals.
View Details
Poly Phosphoric Acid
We hold expertise in exporting, manufacturer and supplying Vitamin B12 Cyanocobalamin from Vadodara, Gujarat. Vitamin B12 Cyanocobalamin used for memory loss, Alzheimer’s disease, to slow aging, and to boost mood, energy, concentration, mental function, and the immune system. It is also used for heart disease, clogged arteries and decreasing the risk of re-clogging arteries after surgery, high triglyceride levels, lowering high homocysteine levels (which may contribute to heart disease), male infertility, diabetes, diabetic nerve damage, nerve damage in the hands or feet, sleep disorders, depression, mental disorders, schizophrenia, weak bones (osteoporosis), swollen tendons, AIDS, inflammatory bowel disease, diarrhea, asthma, allergies, a skin disease called vitiligo, and skin infections. The offered Vitamin B12 Cyanocobalamin is appreciated for its long shelf life. We use hygienic packaging materials for packing of Vitamin B12 to eliminate risk of contamination. Buyers can obtain small or bulk quantities of Vitamin B12 Cyanocobalamin from us at minimal rates.
View Details
Cyanocobalamin Vitamin B
We are Authorised sub Distributors of INKABOR SAC from Peru for All India sub distribution of Borax Decahydrate.
View Details
Borax Decahydrate
Manufacturer, exporter & supplier of Ammonium Dihydrogen Phosphate inorganic chemicals. Available in grade of food, LR, AR, ACS, IP, BP, USP along with COA, MSDS and packing.
View Details
Ammonium Dihydrogen Phos
Pat impex is a leading manufacturer, supplier, trader of industrial cholic acid importer in India. holic acid, also known as 3α,7α,12α-trihydroxy-5β-cholan-24-oic acid is a primary bile acid[1] that is insoluble in water (soluble in alcohol and acetic acid), it is a white crystalline substance. Salts of cholic acid are called cholates. Cholic acid, along with chenodeoxycholic acid, is one of the two major bile acids produced by the liver, where it is synthesized from cholesterol. These two major bile acids are roughly equal in concentration in humans. Derivatives are made from cholyl-CoA, which exchanges its CoA with either glycine, or taurine, yielding glycocholic and taurocholic acid, respectively.Cholic acid downregulates cholesterol-7-α-hydroxylase (rate-limiting step in bile acid synthesis), and cholesterol does the opposite. This is why chenodeoxycholic acid, and not cholic acid, can be used to treat gallstones (because decreasing bile acid synthesis would supersaturate the stones even more).
View Details
Cholic Acid

INR 13824 INR 13899
You Save: INR 75 (0.54%)

Klucel hydroxypropyl cellulose (HPC) is a nonionic water-soluble cellulose ether with a remarkable combination of properties. It combines organic solvent solubility, thermoplasticity and surface activity with the aqueous thickening and stabilizing properties characteristic of other water-soluble cellulose polymers available from Ashland. Klucel HPC films are flexible without plasticizers and non-tacky at high humidity.
View Details
Klucel hydroxypropylcell
Tartaric acid is used as an acidifier, flavour enhancer, antioxidant, stabilizer and sequestering agent. Looking for buy ? Please contact us. Made by INDUSTRIA CHIMICA VALENZANA
View Details
Tartaric acid
1,4,7-Triazacyclononane is a macrocyclic polyamine and its derivatives are extensively used as catalysts, chelators for medical imaging and bleaching agents. With the utilization of modern processing techniques and technology, we are able to manufacture a dependable range of 1,4,7-Tritosyl-1,4,7-triazonane, 1H-1,4,7-Triazonine, and more. These are prepared in our in-house processing facility under the stern observation of researchers, experts while adhering to strict quality assurance at all levels. Streamlined chemical reaction process allows us to produce unmatched quality 1,4,7-Triazacyclononane with assured features and characteristics. Further, these are provided at industry leading prices and are packed safely in glass bottle to restrict leakage during transit.
View Details
1,4,7-Trimethyl-1,4,7-Tr
1-Bromonaphthalene LR AR finds the most common application for determination of crystals refraction and as embedding agent for microscopy. Its chemical formula is C10H7Br with the molar mass of 207.07 g/mol and density of 1.48 g/ml. This compound has a very high refractive index and shows the melting point of about 1 to 2 degrees Celsius with a boiling point range of 132-135 degrees C. It is a colorless organic liquid that can industrially be produced by the reaction of naphthalene with bromine. 1-Bromonaphthalene LR AR offered by us is highly pure in nature and is available at reasonable prices in large quantities. Because of its high refractive index, 1-bromonaphthalene is used as an embedding agent in microscopy and for determining the refraction of crystals.The compound is also used as a precursor to various substituted derivatives of naphthalene. Effective determines crystal refraction Functions as embedding agent Includes elevated refractive index The organic and colorless fluid material
View Details
1-Bromonaphthalene

INR 6127 INR 6200
You Save: INR 73 (1.18%)

Our company is instrumental in presenting an electrochemical grade of lithium chloride. Our lithium chloride is extensively used as a component of the electrolyte in lithium batteries. It is also used as a desiccant for drying air streams.
View Details
LITHIUM CHLORIDE 40%

INR 475 INR 480
You Save: INR 5 (1.04%)

We export Sodium Formaldehyde Bisulphite, which is a white, shining, crystalline material. These are chemicals are used in an application like lithography & photographic use and x-ray fixer & platting. Moreover, it also used to control metallic impurities in a bright nickel bath.
View Details
Formaldehyde-sodium bisu
We are one of the leading suppliers and importer of Thiamine Hcl Vitamin B1, used in pharmaceutical, food, dairy, beverages industries.
View Details
Thiamine Hcl Vitamin B1
Polymethyl Methacrylate PMMA or acrylic is a widely used transparent plastic material known for its applications in various markets from car windows, smartphone screens to aquariums. It is a tough plastic, easy to shape and a great alternative to the high cost and less resilient glass.GSFC make Polymethyl Methacrylate available at lowest price.
View Details
Polymethyl Methacrylate
We manufacture and supply Best quality of Hydrated Lime Manufacturer, We are vadodara based manufacturer, our Quality analysis department and Research and development department make sure that our quality is superior to our all competitors.Our organization provides a wide assortment of Hydrated Lime Manufacturer, which is widely used for construction purposes. We assure premium quality of our range since, we our quality analysts rigorously check the entire procured line of products. When used as a building material, Hydrated Lime is highly cost-effective. Further, these reduce the reaction time of chemical reactions, owing to its purity.All Grades Hydrated Lime Available in stock ex. Vadodara, Gujarat, India.Application of Hydrated Lime : Construction, ETP, Paint and chemical Industry in India.
View Details
Hydrated Lime Powder
Composite acrylic polymer based cementitious crack resistant flexible waterproofing coating, MoistureZero is formulated specially for use in combination with all kinds of cement blends.It is to be used in cementitious slurries as a polymerizing agent and modifier to enhance durability of slurry against moisture ingress along with resistance to hair line cracks.Better performance as compared to similar products like Tapecrete P151 or others.Sunken areasWater bodiesTerraces where roof garden not presentCoverage:It depends on the substrate type (smooth or rough) and application skills.On Smooth Concrete 1Kg / 2 Coats / 15-20 Sq. FtOn Smooth Concrete 1Kg /3 Coats with Fibre layer / 8-12 Sq. Ft
View Details
BUILDSMART BS MoistureZe

INR 235 INR 252
You Save: INR 17 (6.75%)

Pat Impex is a leading dealer & distributor of BASF MasterEmaco 131, BASF MasterEmaco 131, BASF MasterEmaco 488, BASF MasterEmaco S 346, BASF MasterEmaco S 348, BASF MasterEmaco SBR 2, BASF MasterEmaco SBR 2.BASF’s MasterEmaco product system under the Master Builders Solutions brand offers comprehensive solutions for concrete that has been damaged or deteriorated by changing weather conditions, chloride ions, contaminants and extreme environments.The MasterEmaco portfolio of primers, cementitious and resinous repair mortars and fairing coats make up a complete system approach that is used to substitute deteriorated concrete and re-establish the original strength, structural integrity and aesthetics.Formulated to be wet or dry spray applied, formed or hand troweled, the MasterEmaco line of superior performance products re-establish the long-term durability and load bearing capacity of concrete. Working quickly to allow a fast return to service, they match the concrete’s strength, improve the aesthetics and prolong the lifecycle of the building or structure.
View Details
MasterEmaco

INR 33 INR 38
You Save: INR 5 (13.16%)

It is a free flowing white crystals, very slightly soluble in water and in other acids.It is used in manufacturing of Titanium, and manufacturing of Aluminium Titanium Boron alloys for grain refining of aluminium metal. It increases the strength of aluminium metal and its alloy.
View Details
Potassium Hexafluorotita
Pat Impex, a leading importer of CELPHERE Asahi Kasei Corporation , CELPHERE™ is a 100% microcrystalline cellulose (MCC) spheres. It is a neutral substrate for manufacturing of microgranules. It has no smell nor odor. It is insoluble in organic solvents such as ethanol. We have all brands of CELPHERE, CELPHERE SCP-100, CELPHERE CP-102, CELPHERE CP-203, CELPHERE CP-305, CELPHERE CP-507 available in stock.
View Details
CELPHERE microcrystallin
Pat impex is a leading importer and suppliers of innophos brand Dicalcium & Tricalcium Phosphate. Available in 25 kgs and 50 kgs packing. Other innophos brands CALIPHARM A-D-T, DI-TAB, NUTRA TAB, TRI-TAB, VERSACAL MP available in stock.
View Details
Innophos Dicalcium & Tri
Calcium Carbonate precipitated ApplicationPrecipitated Calcium Carbonate is used as paper coating for premium quality paper productsRubber IndustriesPVC/ Plastic industriesFlattering agent in Paint IndustriesIn thermal & electrical InsulatorsFor making Tooth PastePharmaceuticalsFood industriesPCC is synthetically processed from naturally occurring high grade lime stone.The major advantage of the product is its availability in different bulk densities from 0.40 gms/cc to 0.9 gms/cc, with brilliant white color, depending upon the requirement of end user.The assay (purity) of material is around 98.0 % as CaCO3. The material is fluffy and free from inclusions.
View Details
Calcium Carbonate Precip
Importer & suppliers of ADENOSINE MONOPHOSPHATE. Adenosine monophosphate (AMP), also known as 5'-adenylic acid, is a nucleotide. AMP consists of a phosphate group, the sugar ribose, and the nucleobase adenine; it is an ester of phosphoric acid and the nucleoside adenosine. As a substituent it takes the form of the prefix adenylyl.
View Details
ADENOSINE MONOPHOSPHATE
High quality ACITRETIN pharma neutraceuticals available with us. We are a self importer of this products in 1 kg & 5 kgs packing. Available in stock
View Details
ACITRETIN
Ammonium Bromide is known as Ammonium Bromatum, Azanium bromide, Nervine, Ammonium bromide ((NH4)Br) and has Molecular Formula of BrH4N and Molecular Weight of 97.94246. It is manufactured through passing bromine in aqueous solution over iron filings which leads to the formation of ferric & ferrous bromide solution that is further treated with ammonia.Available in form of cubic, colloidal crystals or as white crystals/granules or as colourless crystals or in form of yellowish-white crystalline mass, it is odourless in smell and has a saline taste. Its other properties include Boiling Point of 235°C (vacuum), Melting Point of 452°C sublime, Density/Specific Gravity at 2.429 @ 25°C and solubility in ether, ammonia, acetone and in water.
View Details
Ammonium Bromide
Pat Impex is a leading manufacturer, exporter and supplier of Phenyltrimethylammonium Chloride 98% powder. This compound used in :Surface-active agentsSolventsIntermediatesActive Ingredient for ConditionersAntistatic AgentDetergent SanitisersSoftner for textiles and paper productsPhase Transfer CatalystAntimicrobialsDisinfection Agents And SanitizersSlimicidal AgentsAlgaecideEmulsifying AgentsPigment Dispersers
View Details
Phenyltrimethylammonium

INR 275 INR 300
You Save: INR 25 (8.33%)

We are a importer & suppliers of Nitrofurantoin pharma raw material in India. Nitrofurantoin is an antibiotic that fights bacteria in the body. Nitrofurantoin is used to treat urinary tract infections. Nitrofurantoin may also be used for purposes not listed in this medication guide.
View Details
NITROFURANTOIN
We are offer to sell Indian Peanut or Groundnut oil EP & BP Pharma grade. Offer to sell high quality groundnut oil that is mostly used by pharmaceutical and food industries in India.
View Details
GROUNDNUT OIL EP & BP Ph
Offer to sell Caustic Soda Flakes make Grasim/DCM shriram/GACL/Meghmani. We are a authorized distributor of Caustic Soda Flakes in India.
View Details
Caustic Soda Flakes

INR 1599

Manufacturer, exporter & supplier of Readymade shampoo base chemicals for the manufacturing of shampoo process at the very lowest price. We are a largest manufacturer of shampoo base raw material in India.
View Details
Readymade Shampoo Base C
We are a unique entity in the market, actively committed towards offering an optimum grade of China Clay Powder. Under the stern vigilance of dexterous professionals, our offered powder is processed using premium quality chemical compounds and sophisticated processing techniques. For its accurate composition, our provided powder is widely appreciated among our patrons. Sourced from authentic vendors, quality examiners check this powder against diverse quality parameters to avoid any possible flaws.Major Uses: PVC cables high voltage insulating materials Low and medium voltage electric cable insulation Mechanical rubber goods Elastomers PVC Polyamide Other plastic / rubber applicationsApplication Rubber MB
View Details
China Clay Powder
By efficiently understanding the market trends, we are able to manufacture, supplied and trading of Calcium Asparto Glycinate. We offer pure grade powder of Calcium Asparto Glycinate for pharmaceutical tablet manufacturer in India.
View Details
Calcium Asparto Glycinat
Leading manufacturer & supplier of Acetonitrile solvents.Leveraging the skills of our qualified team of professionals, we are instrumental in offering a wide range of Acetonitrile Solvent.Ethanenitrile, Cyanomethane, Ethyl nitrile, Methanecarbonitrile, Methyl cyanidePurity 99.5% MinimumDensity (g/Cm Cube) 786 kg/m3Boiling Point (deg. Celsius) 82Melting Point -45Molar Mass 41.05 g/mol
View Details
Acetonitrile

INR 183 INR 190
You Save: INR 7 (3.68%)

We are counted as one of the leading suppliers and traders, offering the best quality of Acetone Chemical Compound & Solvents. Due to its accurate composition and longer shelf life, the offered vinyl acetate monomer is highly demanded. Due to our rich vendors’ base and spacious storage facility, our patrons can avail the offered vinyl acetate monomer in bulk quantities, as per their needs and requirements. Features:Compositional accuracyEnhanced shelf lifeHigh density
View Details
Acetone

INR 47 INR 52
You Save: INR 5 (9.62%)

Distributors, Stockist, Importers, Agents of Chemours BASF Titanium Dioxide rutile R 105-706-350Superior weather resistanceOutstanding properties in molding and extrusion resinsExcellent opacity and neutral undertoneVery high dispersibility in plasticized vinyl, plasticizers, and liquidsFlocculation resistanceGood gloss retentionResistance to chromaphore formationApplications where Ti-Pure™ R-105 is of particular value are:Injection molding, blow molding, and blown film of polyethylene or polypropyleneRigid interior, flexible, and plastisol PVC, as well as PVC used for composite and sheet flooringLead-stabilized PVC systems and nonchalking exterior PVCDurable exterior polyethylene or polypropyleneExterior architectural applications requiring high gloss and maximum durabilityEmulsion trim paints where maximum initial gloss and outstanding exterior durability are preferredRefinish and OEM topcoat applications requiring high gloss, distinctness of image, and resistance to weatheringManufacturing operations demanding fast wet-in and easy dispersionHigh-durability industrial applications including coil coatings for residential aluminum siding, architectural building panels, and aerospace coatingsThermoplastic masterbatches needing high concentrations of pigment and minimal melt flow impactPolyolefin products with improved resistance to additive yellowingPolyolefin films for outdoor applicationsABS ApplicationsAutomotive OEM topcoat and refinishAerospace coatingsPremium-quality exterior finishes and high durability exterior coil coatingsPowder coatingsIndustrial OEM
View Details
Chemours Titanium Dioxid

INR 275 INR 280
You Save: INR 5 (1.79%)

Chemours (BASF) Distributors, Stockist, Importers, Agents Rutile Ti-Pure™ R-104 is a general-purpose rutile titanium dioxide pigment designed primarily for plastics applications. Manufactured by the chloride process and supplied as a fine, dry white powder, it is specifically formulated toOffer fine particle size distributionGive outstanding melt flow with highly loaded thermoplastic masterbatchesCombine high brightness and high tinting strength with the bluest vinyl undertoneOffer excellent lacing resistance in high-temperature cast film and extrusion coating applicationsApplications where Ti-Pure™ R-104 is of particular value are:Engineering resin applications where high opacity at low loading is requiredThermoplastic masterbatches where high concentrations of pigment are desiredMelt flows that are minimally affected
View Details
Chemours Titanium Dioxid
The substance is also used for parasite control and for drinking water disinfection. Chloramine-T is as an algicide, bactericide, virucide, fungicide (including spores), germicide. It is also effective against mycobacteria such as tuberculosis, foot-and-mouth disease and avian influenza.Tosylchloramide or N-chloro tosylamide, sodium salt, sold as chloramine-T, is a N-chlorinated and N-deprotonated sulfonamide used as a biocide and a mild disinfectant. It is a white powder that gives unstable solutions with water. Trade names of chloramine-T products include Chloraseptin, Chlorazol, Clorina, Disifin, Halamid, Hydroclonazone, Trichlorol, Minachlor, and generic Chloramin T or Tosylchloramide Sodium, among others.Iodination and radioiodinationBiocideProtective agent
View Details
Chloramine T
We are one of the prominent manufacturers, exporters and suppliers of high quality Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical. Offered chemical is processed in a very hygienic environment by utilizing quality approved chemical substances. This chemical finds broad applications in cosmetic and soap industry for adding soothing fragrances. Further, this chemical is tested on various quality parameters to ensure its high effectiveness. Besides, our clients can obtain this Yara Yara Beta Naphthyl Methyl Ether Perfumery Chemical from us in different packaging options at nominal rates.Application in : Incense Sticks ( Agarbatti ), bakhoor, dhoop & loban, Fine Fragrances & Soap Perfumes, Detergent Powders, Cosmetics & Toiletries.
View Details
Yara Yara Beta Naphthyl

INR 350 INR 360
You Save: INR 10 (2.78%)

The main characteristic of Zeolite 4A is its 4 angstrom pore size. This micro-porous desiccant does not allow molecules larger than 4 angstrom to pass through, thus help keep vapour and other impurity molecules at bay. 4A Zeolite is used to adsorb a wide range of molecules like water, methanol, ethanol, sulfureted hydrogen, carbon dioxide, ethylene and propylene, to name a few. The 4A type of Zeolite has a bulk density of 0.60–0.65 g/ml.There are many uses of 4A Zeolite across different industries. It is mainly used in the deep-drying of air, natural gas, alkane and refrigerant. It also finds use in the drying of electronic elements, pharmaceutical and other unstable elements. Another utilization of this type of Zeolite includes solvent drying, purifying and drying gases like ammonia, drying of aromatics and other liquid hydrocarbons.4A Zeolite is also used in removing gases like carbon dioxide from natural gases as well as steam cracked gases. This helps in the smooth flow of these gases in their respective gas streams.
View Details
Zeolite 4A

INR 22 INR 25
You Save: INR 3 (12%)

Our company has succeeded to achieve respectable position in the market by offering our clients Sodium Meta Silicate Anhydrous. Sodium metasilicate anhydrous is strongly alkaline, having strong capacity of cleaning, buffering and softening, counteracting acidic contamination, emulsifying fat and oil, deflocculating to inorganic. Sodium metasilicate anhydrous is an inorganic white powder or crystalline granules, non-toxic, tasteless and environment-safe. It is easy soluble in water, insoluble in alcohol or in acid producing an alkaline solution, very hygroscopic when reacting with CO2 and water from the air. Applications:Metal treatment chemicals,Ceramic Industrial ,DetergentCleaning powder,Specialty Chemicals
View Details
Sodium Metasilicate

INR 51 INR 55
You Save: INR 4 (7.27%)

Lithium Carbonate Manufacturer Lithium carbonate is an inorganic compound, the lithium salt of carbonate with the formula Li2CO3This white salt is widely used in the processing of metal oxides.For the treatment of bipolar disorder, it is on the World Health Organization's List of Essential Medicines, the most important medications needed in a basic health system.Other names : Dilithium carbonate, Carbolith, Cibalith-S, Duralith, Eskalith, Lithane, Lithizine, Lithobid, Lithonate, Lithotabs Priadel, ZabuyeliteCAS Registry Number: 554-13-2Chemical formula : Li2CO3
View Details
Lithium Carbonate
We are one of the reliable organizations engaged in providing clients with Ferrous Sulphate Powder, which is reckoned for its purity. In this product range, we also offer Ammonium Ferrous Sulphate and Ferrous Sulphate Monohydrate to our clients. The entire range of chemicals offered by us is processed at the vendors' end under hygienic and sterile environment. Clients can avail these chemicals in high-grade packaging of varied quantities, as per the requirement. Price may vary.
View Details
Ferrous Sulphate

INR 17 INR 24
You Save: INR 7 (29.17%)

We are a manufacturer & supplier of Zinc Sulphate Heptahydrate zn 21% in India.As Mordant in Calico-Printing; Preserving Wood & Skins; with Hypcochlorite for Bleaching Paper, Manufacturing Lithopone & other Zinc Salts; Clarifying Glue; Electrodepositing Zn; also as reagent in analytical Chemistry.
View Details
Zinc Sulphate Heptahydra

INR 34 INR 42
You Save: INR 8 (19.05%)

We are a manufacturer & suppliers of Lithium Acetate dihydrate, anhydrous & solution in India.Lithium acetate dihydrate is a salt of lithium and acetic acid. Lithium acetate dihydrate is used in ester interchange catalyst in polyester production, anticorrosion agent in molding polyphenylene sulfide resins, and a catalyst in alkyd resin and acrylic polymer production.
View Details
Lithium Acetate Anhydrou
Boron is an ideal Boron Fertilizer. It increases profit by maximizing yield. With sincere efforts, we have successfully been engaged in manufacturing and supplying a superior quality of (Boron-10%). This is processed with the use of boron chemicals and by the aid of sophisticated techniques under our adroit professionals. It is used in foliar and drip irrigation applications as insecticides, pesticides and fungicides. In addition to this, the offered (Boron-10%) is available in the market at reasonable prices from us.Benefits:It helps in new cell formation and root developmentIt helps in formation of protein and amino acidIncrease number of flowers and fruitEnsures growth and high yield of all cropRecommended Crops:Wheat, Maize, Sugarcane, Rice, Sorghum, Cotton, Pigeon Pea, Sunflower, Groundnut, Soybean, and Vegetables like Tomato, Brinjal, Chilly etc., all types of Fruits Crops and Tea & Coffee.
View Details
BORON 10%

INR 105 INR 110
You Save: INR 5 (4.55%)

Formulated using Phosphorous 52% and Potassium 34%, Special NPK (00-52-34) is a 100% water soluble fertilizer which promotes the soil fertility. It is a great source of P & K soil nutrients for plants, specially useful during early and end stages of crop growth.Content:N (Nitrogen) : 00%P (Phosphorous): 52%K (Potassium) :34%Advantages:Complete Plant FoodHighest Nutrition ContentExcellent Chemical PropertiesSuitable For Fruit DevelopmentIt's Good Vegetative Development Gives Scope For Good YieldRecommended Crops:Cereals & Fibres ( Rice, Wheat, Maize, Cotton, etc.).Tomato, Onion, Potato, Groundnut, Sugar Beets, Legumes other Vegetables crops.Commercial crops like Sugarcane, Tea & Coffee, etc.Fruits ( Grapes, Mango, Apple, Banana, Citrus, Strawberry, Pomegranates etc.) and other fruits.Flower ( Roses, Marigold, Carnation, Gerbera etc.) & other flowers.Dosage & Application:Foliar Application:- 100 gm per pump or 15 litre water.Soil Application: - 5 kg per acre.Packing Available: 1 kg, 25 kg & Bulk.
View Details
NPK 00:52:34

INR 85 INR 90
You Save: INR 5 (5.56%)

We are a importer & suppliers of 1, 2, 3 Benzotriazole (BTA) that is used in antirust oil (grease) products, widely used in air phase corrosion inhibitor and circulating water finishing agent in copper and copper alloy, motor vehicle antifreeze fluid, photo antifoggant, macromolecule stabilizer, plant growth regulator, lubricating oil additives, ultraviolet absorber etc. It can be also used with various antisludging agent and germicidal agent.
View Details
1, 2, 3 Benzotriazole (B

INR 670 INR 680
You Save: INR 10 (1.47%)

We are a importer & supplier of Gluconic Acid 50%.Gluconic acid is an organic compound with molecular formula C6H12O7 and condensed structural formula HOCH2(CHOH)4COOH. It is one of the 16 stereoisomers of 2,3,4,5,6-pentahydroxyhexanoic acid.Gluconic acid occurs naturally in fruit, honey, and wine. As a food additive, it is an acidity regulator. It is also used in cleaning products where it dissolves mineral deposits especially in alkaline solution. In aqueous solution at neutral pH, gluconic acid forms the gluconate ion. The salts of gluconic acid are known as
View Details
Gluconic Acid 50%

INR 75 INR 80
You Save: INR 5 (6.25%)

We are proficient in supplying a wide range of Anhydrous Ammonia that is largely utilized by our customers in nitrogen fertilizer. According to the convenience of the customers, we are delivering this chemical substance in a variety of cylinder sizes like 40, 50, 60 and 225 kg. So as to cater to the exact necessities of the users, we are supply this chemical pure forms varying from 95.5% to 98.5% in tankers and cylinders sizes.
View Details
Anhydrous Ammonia

INR 120 INR 125
You Save: INR 5 (4%)

We have achieved a unique position in the industry by offering our customers an excellent range of Aluminium Nitrate. Used in varied industries, the offered range is processed under the observation of adroit professionals, who are well-versed in this domain. Product Details:EffectiveAccurate compositionEnsures purityEco
View Details
Aluminium Nitrate

INR 127 INR 145
You Save: INR 18 (12.41%)

Offer to sell Sodium Sulphite (sulfite) solution at best price. We offer 15% sodium sulfite solution specification in Tanker Load and small packing. Byproduct, waste and surplus sodium suphite solution available.
View Details
Sodium Sulphite Solution
With innovative approach, we are able to offer high quality range of zircon sand. These are prepared utilizing zircon, which is a top quality raw material which is available in bulk with us. Further, this sand is finished in such a manner that these are able to retain their shine for the lifetime. This sand is obtainable in wide ranging specifications and is available at reasonable prices to our customers.
View Details
Zircon Sand

INR 82 INR 85
You Save: INR 3 (3.53%)

Pat Impex is a leading importer and supplier of Polyvinyl Chloride PVC Resin. We are a importer of Polyvinyl Chloride PVC Resin from Thailand, Gulf Countries, LG, Hanwha, ocean, georgia, ineos in India.
View Details
Polyvinyl Chloride PVC R
Pat impex india is a exporter, manufacturer, supplier of pharmaceutical Blonanserin which is used in pharma formulations, tablets, pharma intermediates, pharma chemicals. We are approved by GMP and other certification for this product. Please contact for price and other details.
View Details
Blonanserin

INR 625000

Buy high quality polyelectrolyte (Grade - Anionic, Cationic, Non Ionic) manufacturer, supplier, exporter, importer, dealer based at Vadodara, Gujarat, India for waste water treatment, etp treatment, water purification, oil recovery, color removal, paper making, mineral processing. It has anionic emulsions and dry polyacrylamides which can be used wherever liquid/solids separation is needed in industrial effluent treatment applications.
View Details
Polyelectrolyte
Peracetic acid is an environmentally safe and versatile anti-microbial agent and a powerful antioxidant. It emits oxygen at lower temperatures than other bleaching agents. It is effective against micro-organisms and is not deactivated by catalase and peroxidase, the enzymes that break down hydrogen peroxide. It is widely used in food applications.Dairies, wineries, breweries and beverage plants,Meat and poultry processing and packaging,Milk and dairy products processing and packaging plants,Seafood and produce processing and packaging plants,Food processing and packaging plants,Egg processing and packaging equipment surfaces,Eating establishments
View Details
Peracetic acid
Buy high quality Isopropyl Alcohol Solvents IPA manufacturer, exporter, supplier, importer, dealer, distributor, trader based in Vadodara, Gujarat, India. We offer pure grade, distillation grade, next to pure in Small & Bulk Export packing from Gujarat, India.We are a exporter & manufacturer of this product in foreign countries and available ready stock with COA, MSDS and with CAS in Asia, Australia, Central America, North America, South America, Eastern Europe, Western Europe, Middle East, Africa, All India, UAE, Dubai, Russia, New Zealand, Canada, USA.
View Details
Isopropyl Alcohol
Buy high quality Caustic Soda Flakes, Prills, & Lye gacl/meghmani/dcm make manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Caustic Soda Flakes, Pri
Buy high quality 2-Amino-5-chlorobenzophenone manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
View Details
2-Amino-5-chlorobenzophe

INR 22000

Buy high quality Ambroxol Hydrochloride Hcl manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.Available in : South America, Asia, Africa, Europe, India, UAE, Dubai, Russia, Australia, New Zealand
View Details
Ambroxol Hydrochloride H
Buy high quality Salbutamol Sulphate IP/BP/USP(CAS 51022-70-9) manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Salbutamol Sulphate IP/B

INR 6500

Buy high quality ALBUTEROL SULPHATE manufacturer, exporter, suppliers for pharmaceutical, bulk drugs, intermediates in Vadodara, Gujarat, India.
View Details
ALBUTEROL SULPHATE
High quality pharmaceutical apis bulk drugs intermediates suppliers & manufacturer of ergotamine tartrate from Vadodara, Gujarat, India. Available now in south america, europe, india and worldwide
View Details
Ergotamine Tartrate
Buy high quality Acriflavine hydrochloride hcl powder manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Acriflavine hydrochlorid
Buy high quality Aceclofenac manufacturer, supplier, importer, dealer, distributor, trader used in pharma intermediate, bulk drugs, apis, pharma chemicals, chemical compound for pharmaceutical and chemicals industry available at lowest rate.
View Details
Aceclofenac
Pat Impex is a leading suppliers, exporters, importer, manufacturer of 4-(Piperidin-4-yl)morpholine in small and bulk packing pharmaceutical api intermediates for pharma manufacturing in India, Gujarat, Worldwide.
View Details
4-(Piperidin-4-yl)morpho
Pat Impex is a leading manufacturer, exporter, importer and supplier of N,N-Diisopropylethylenediamine pharma apis, intermediates available in Vadodara, Gujarat, India. High quality N,N-Diisopropylethylenediamine that you can trust.
View Details
N,N-Diisopropylethylened
Pat Impex is a leading manufacturer & exporter of Sodium Hypochlorite solution 1-14% in Vadodara, Gujarat, India. Manufacturer Capacity - 1,00,000 MT/AnnumExporter & Importer in Dubai, UAE, Saudi Arabia, Europe, USA, Canada, South America
View Details
Sodium Hypochlorite
#Povidone Iodine suppliers in South America, Europe, Asia.Pat Impex is a leading suppliers, exporters, manufacturer of Povidone iodine in small and bulk packing available in Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Guyana, Paraguay, Peru, Suriname, Uruguay, Venezuela, South America & Europe.
View Details
POVIDONE IODINE BP USP I

INR 2700 INR 2800
You Save: INR 100 (3.57%)

Pat Impex is a leading manufacturer, exporter, importer, dealer & distributor of Trichloroisocyanuric Acid - Tcca 90% for swimming pool treatment available in lowest rate in Vadodara, Gujarat, India.
View Details
TRICHLOROISOCYANURIC ACI

INR 230 INR 235
You Save: INR 5 (2.13%)

  • Filter Using Product Tags

sodium hypochlorite |south america |usa |india |uae |importer |canada |europe |manufacturer |duabi |exporter |top chemical company in india |4-(Piperidin-4-yl)morpholine |asia |supplier |africa |australia |russia |america |PHARMACEUTICALS |PHARMACUTICALS |pharmaceutical |Topiramate |Bromhexine hydrochloride |Calcium levulinate |pharmaceuticals |Ferric ammonium citrate |Pharmaceutical |laboratory |Pharmaceuticals |cbsx basf powder |Detergent chemicals |optical brightener |paper brightener |fiber whitener |textile whitener |color correction |pharmaceutical intermediates |apis |bulk drugs manufacturer in india |gujarat |suppliers |pharma |bulk drugs |api |uk |intermediates |Salbutamol Sulphate IP/BP/USP |sorbitol |liquid |solution |powder |in india |worldwide |sorbitol 70% solution |dealer |distributor |With the strong knowledge of this domain, our chem |Excellent Antiseptic |Features: |High effectiveness |Zero side effects |Longer shelf life |Chlorhexidine Acetate BP/EP/USP |Carbamazepine |PHARMCEUTICALS |Clioquinol |Fluphenazine Decanoate |granules |bentonite |lumps |Quaternary Compounds |bleaching agent |oxidizing agent |chemicals |Pharmaceutical excipients |Ashland |speciality ingredients |Oxidizing agents |paper industry |r-902 |titanium dioxide |rutile |dupont |acetone |Solvents |pure grade solvents |Foremost 310 |Crystalline Monohydrate |KERRY Ingredient USA |ACITRETIN |India |MasterEmaco |basf |1-Bromonaphthalene |refractive index |embedding agent |bromine chemicals |4-Methoxybenzoic Acid |p-Anisic Acid |Draconic Acid |Activated Carbon |ip |bp |usp |pharmaceutical grade carbon |Glycerine CP |VVF |Adani Wilmar |Godrej |nirma glycerine |Hydrogen Peroxide |chlor alkali |Diphenhydramine Hcl |Clopidogrel Bisulfate |Vinorelbine tartrate |Furosemide |Betahistine Dihydrochloride |Calcium Dobesilate |cosmetic chemicals |PHARMACEUTICAL |P |Lithium carbonate |maharasthra |Hydrofluoric Acid |industrial acid |technical |commercial |Ammonium Bisulphite |Oxygen Scavenger |oil & gas |oilfield chemicals |White Phenyl |liquid cleaner |floor cleaner |H2S Scavenger |oil field chemicals |dubai |qatar |saudi arabia |Methylene Dichloride |chloromethane group |vadodara |Mastertile 25 Grey |construction chemicals |Construction Chemicals in India |fuso chemical |malic acid |fcc grade |Valproic Acid |Voriconazole |Econazole Nitrate |Clorsulon |Cyproheptadine |Seaweed Extract Flake |biochemical fertilizer |organic fertilizer |Aceclofenac |high quality |top pharma company in india |lowest rate |Acriflavine hydrochloride hcl powder |top company |r & d |pharma compound |Povidone Iodine |tbab |manufacturer of tbab in india |phase transfer catalyst |Tetrabutylammonium Bromide |4-n-butyl Resorcinol |Docusate Sodium |Terbutaline Sulfate |pigments chemicals |N-Propyl Bromide |dyes chemicals |food chemicals |Chlorine chemicals |bleaching powder |Agriculture chemicals |inorganic chemicals |antifreeze fluid |antifoggant |pgr |antisluding |germicidal agent |antirust oil grease |corrosion inhibitor |tablet binder |tablet manufacturer |AMMONIUM ADIPATE |food industry |ingredients |mineral fortifiers |Ammonium benzoate |food |rust inhibitor |preservative |adhesives ingredients |coating industry |Potassium Hexafluorotitanate |navin fluorine dealer |Sugar Sweetener |Methyl isobutyl ketone (MIBK) |mibk solvents |top solvents manufacturer in India |4-Amino-6 Chlorobenzene-1,3-disulfonamide |Chloraminophenamide |Idorese |pharma intermediates |solvent c9 |reliance |opel |distilled |c9 solvents in india |solvent |supppliers |ALBUTEROL SULPHATE |north india |APIS |ahmedabad |vapi |germany |south india |ankleshwar |prills |lye |flakes |caustic soda |povi |Argentina, Bolivia, Brazil, Chile, Colombia, Ecuad |pat impex |basf tamol |tamol dn |pharma intermediate |Pregabalin |Amiloride Hcl |lactose |pharma excipients |fertilizer |soil nutrients |Agriculture |crop protection |Aluminium Nitrate |Manufacturer |Readymade Shampoo Base Chemicals |shampoo raw material |shampoo manufacturing chemicals |calcium carbonate precipitated |gacl |aditya birla |rayon |century birla |indian peroxide |national peroxide |Hydrogen Peroxide 35%, 50%, 60%, 70% w/w |Sodium trimetaphosphate |Industrial chemicals |commercial grade |Hydrogen Bromide |hbr solution |acetic acid |hydrobromic acid |bromide derivatives |Methanesulfonic anhydride |exporters |White Petroleum Jelly |Chlorhexidine Gluconate |all india |Coco Monoethanolamide |Anhydrous Aluminium Chloride |chlorine |alkali chemicals |4-(N-Boc-amino)piperidine |antagonist |CAS 73874-95-0 |PVP K 90 Ashland |Pharmaceutical Impurities |chemical impurities |Nitrofurantoin |hyderabad |chennai |Dicalcium Phosphate |Tricalcium Phosphate |CALIPHARM A-D-T |DI-TAB |NUTRA TAB |TRI-TAB |VERSACAL MP |Food & Nutraceuticals Industry |Innophos |1,4,7-Triazacyclononane |chelators |medical imaging |GLUCOSAMINE SULPHATE SODIUM CHLORIDE- USP |Borax |ph |eur |grade |PVC Resin |Polyvinyl Chloride |Desloratadine |Acefylline piperazine |Diphenoxylate hydrochloride |Glipizide |silica sand |white sand |quartz |JRS Pharma |BASF Excipients |Contract Manufacturing |Bulk Drugs |tablet |chemours |meghmani |DCM Shriram |Grasim |Ammonium Bromide |roasted |black granules |steam coal |Polymethyl Methacrylate |pmma |gsfc |acrylic |plasticizers |Thiamine Hcl |Vitamin B1 |Tartaric acid |INDUSTRIA CHIMICA VALENZANA |2-Cyanoacetamide |2-CHLOROETHYL MORPHOLINE HYDROCHLORIDE |drug intermediates |Sodium Trimetaphosphate |dairy stabilizing agent |meat processing |cheese stabilizer |pharma grade |starch industry |Sodium carboxymethylcellulose |Cosmetic Chemicals |fertilizers |crop growth |Lithium Acetate |dihydrate |lithium anhydrous |ferrous sulphate |monohydrate |ammonium |teepol b 300 |RECKITT BENCKISER teepol b |india teepol suppliers |Hydrated Lime |Glitter Powder |textile |calcium carbonate |bp usp |ip 85 96 |ph eur |2-CHLOROETHYL AMINE HYDROCHLORIDE |iron ore |minerals |byproduct |hydrochloric acid |tanker load |surplus chemicals |gacl hydrochloric acid dealer in india |hcl 32% |carboys packing |hcl |surplus acid |peracetic acid |peroxy acetic acid |dairy chemicals |egg chemiclas |seafood chemicals |milk & dairy chemicals |food processing chemiclas |biocides |Vardenafil Hcl Trihydrate |Blonanserin |formulation |Potassium iodide |Venlafaxine Hcl |Cetirizine Di Hcl |1-Chloroethyl cyclohexyl carbonate |cellulose |Calcium Chloride Liquid |best gravity |manufacturer of liquid calcium chloride |ceramic morbi |detergent |metal treatment |Vadodara |Morbi |Gujarat |perfumery chemicals |perfumery chemicals manufacturer |agarbatti |detergent powder |cosmetics |Uttar pradesh |Madhya Pradesh |Phenyltrimethylammonium Chloride |lithium chloride solution |lithium chloride 40% |Treatment for autoimmune disease |N- ACETYL GLUCOSAMINE |bulk |Alkyl Dimethyl Benzyl Ammonium Chloride |Benzalkonium Chloride |bkc |tamol nn |tamol |Chloramphenicol Palmitate |Promethazine HCL |Chlorhexidine and its salts |concrete |Metakaolin |wall putty |Fexofenadine HCl |lactose, pharma excipients |Inorganic Chemicals |excipients |Phase transfer catalyst |surfactant |Emulsifiers |flame retardant |ion exchange |buy |sale |sell |2-Amino-5-chlorobenzophenone |ipa |isopropyl alcohol |solvents |thailand |small packing |bulk packing |Ferric Chloride |Water treatment chemicals |china clay powder |Dextromethorphan Hbr |Paint Industry |Paint Additives |chloramine T |MIDDLE EAST, NORTH AMERICA, SOUTH AMERICA, EASTERN |Formaldehyde-sodium bisulfite adduct 95% |Formaldehyde |lithium chloride |klucel |ashland |Cyanocobalamin |vitamin b12 |Sodium nitrate |deepak nitrite ltd |deepak sodium nitrate |waste |sodium |nitrate |Bis(2-chloroethyl)amine hydrochloride 98% |N,N-Diisopropylethylenediamine |anionic |polyelectrolyte |effluent treatment chemicals |non ionic |waste water treatment |eff |cationic |water treatment chemicals |etp chemicals |polyacrylamides |manufacfurer |Water Treatment Chemicals |Lauric Monoethanolamide |fatty acids |amide |Coco Diethanolamide |Tinidazole |Esomeprazole Magnesium |fresh |recover |Laboratory chemicals |Blue acid |substitute |textile industries |BASF PEG |BASF |dupont chemours dealer |groundnut oil |peanut oil |a-tab |innophos |dicalcium phosphate |Ammonium Dihydrogen Phosphate |food, LR, AR, ACS, IP, BP, USP |USA |Acid Corrosion Inhibitors |industry |3-(3-dimethylaminopropyl)carbodiimide |EDC |EDAC |EDCI |non ferric alum |ferric alum |MasterFlow 718 |ASBESTOS POWDER |asbestos mineral powder |rajasthan |Chlorpheniramine Maleate |goa |best chemical company |swimming pool chemical |tcca 90% |trichloroisocyanuric acid, |china |Magnesium Chloride Hexahydrate |fob |price |packing |mineral |middle east |Citalopram Hydrobromide |Albuterol Sulfate |Ferrous gluconate |Potassium Magnesium Sulphate |agriculture grade |fertilizer grade |Carbomer |carbopol |Agriculture Fertilizers |Crop chemicals |Borax Decahydrate |INKABOR SAC |Poly Phosphoric Acid |Phosphorous Derivatives |agro chemicals |Dicyandiamide |DCDA |quality |GLUCOSAMINE HYDROCHLORIDE USP |N-iodosuccinimide |Salbutamol Sulphate |ergotamine tartrate |vadoadra |bulk drugs manufacturer |drugs |new zealand |asprin |copper sulphate |industrial grade |Cinnarizine |pharma additives |Cosmetic chemicals |c.p. grade |l.r. grade |a.r. grade |application |tanker load packing |ADENOSINE MONOPHOSPHATE |IMPORTER |cholic acid |Papaverine hydrochloride |Chemicals |Pellets Activated Carbon |Granular Activated carbon |Powder Activated Carbon |Chemically Activated Carbon |Steam Activated carbon |Wash Activated carbon |Ambroxol Hydrochloride Hcl |intermediate |pharma manufacturing |Ranitidine Hcl |Tadalafil |Febantel |Didecyldimethylammonium chloride (DDAC) |biocide |hospital |surgery |hospital instrument cleaning |sterilization in hospitals |1-Tetralone |kollidon 25 |dispersing |Polyvinylpyrrolidone Polymer |polymer |excipients pharma |Ashland PVP K Series |Xanthan Gum |contract manufacturing |Plasdone |general chemicals |Zircon Sand |maharashtra |zn 21% |zinc sulphate |oxygenation |agriculture |fish farming chemicals |south india peroxide |microcrystalline cellulose |CELPHERE |Asahi Kasei Corporation |waterproofing chemicals |buildsmart |bs moisturezero |Xylitol |sugar substitute |Ursodeoxycholic acid |Calcium Hypophosphite |pharma process chemicals |water treatment |yellow flakes |Sodium sulphide |halazone powder |halazone tablet |Metformin HCL |Choline Magnesium Trisalicylate |Cyclophosphamide |Piroxicam |Fluconazole |Celecoxib |Atenolol |Domperidone Base & Maleate |Crystalline Magnesium Sulphate |inorganic salts |nutrients |crop protection chemicals |Potassium Schoenite |agriculture chemicals |soil protection |Chlorinated Chemicals |starch |glycolate |durgs |Gluconic Acid |gluconates |madhya pradesh |mumbai |boron 10% |Acetonitrile |Praziquantel ip |Praziquantel bp |veterinary api |Glycereth Cocoates |carbopol 940 |CIT MIT Based Biocide |Handwash Concentrate |readymade hand wash |acid slurry |top importer in india |ports in india |THYMOL |Nonyl Phenol Ethoxylated |thyme |quaternary ammonium salt |Ammonium sulphate |pharmaceutical raw materials |food additives |bicarbonate chemicals |benzene |phenol |polyurethanes |insulation application chemicals |engineering chemicals |pipelines chemicals |cross linker chemicals |fulvic acid |fabric softner |clariant chemicals |ethoxylates |mining chemicals |boiler chemicals |thermal power plants chemicals |rubber chemicals |acrylic acid |chelating agent |industrial circulating cooling water systems |air-conditioner chemicals |piperidone |scale inhibitor |industrial fine chemicals |aerosol cleaning chemicals |carpet cleaners |hydrofluorocarbons |tear gas chemicals |foaming agent |basf TINUVIN |Light Stabilizer For Paint Tinuvin |Basf TINUVIN Stock |Ethylene glycol distearate |glycol chemicals |fuel additives |gasoline additives |Flavor and Fragrances chemicals |aromatic chemicals |Potassium Citrate |Ammonium Citrate |Dihydrate Ammonium Citrate |Sodium Dihydrogen Citrate |Tri-Sodium Citrate |medicine grade |pulp & paper industry chemicals |FOUNDRY CHEMICALS |drinking water treatment |citrate chemicals |diacrylates |distribution company in india |super absorbents |skin lightening chemicals |cupric |wood preservative |disinfectant chemicals |insecticides |fungicides |herbicides |pigment intermediates |agro intermediates |pharma fine chemicals |organic intermediates |chemical liquid |Photographic Chemicals |Mix XYLENE India |Solvent Suppliers India |METHYL CYANOACETATE |antiseptic chemicals |Methyl cinnamate |Mono Ethylene Glycol |Para Chloro Meta Xylenol |pcmx |Diclofenac Sodium |4’ CHLOROPROPIOPHENONE |1-(4-chlorophenyl)-1-propanone |Chloroquine phosphate |potassium mono persulfate |AMMONIUM ACETATE |ntifoam, defoamer, defoamer silicone, defoaming ag |defoaming agent |Silicone Antifoams |silicone emulsion defoamer |Isopropyl acetate |pesticides |acid gas absorbent |anti-rust agents |Dimethylformamide dimethyl acetal |dyes intermediates |urea reaction |steroids api |amine |TERT-BUTYLAMINE |aroma chemicals |Sodium Acetate Anhydrous |Aldehyde C-8 Aromatic Chemical |pyridinium salts |(4 To 6%) 5 Liter Sodium Hypochlorite |aibn |azobisisobutyro |methyl |Lithium Carbonate |polyols |coating polymer basf |Ethyl cyanoacetate |Glutaraldehyde 50% |dental cleaning |medical sterilize |Coolant Glycol Liquid |coolant chemicals |Crude Glycerine Liquid |USP Glycerine Liquid |ethyl alcohol |pharmaceutical reaction chemicals |cleaning chemicals |Dodecyltrimethylammonium Bromide |active pharmaceutical ingredients |azithromycin |batteries |animal |alkyl amine chemicals |diamines chemicals |Triethylamine |Diethyl D-tartrate |POTASSIUM MAGNESIUM CITRATE |magnesium chemicals |chromium chemicals |interior chemicals |enamels lacquers chemicals |lubricant |Corrosion Inhibitor |personal care chemicals |surface sterilizer |hygiene chemicals |conditioner cosmetic |CATALYST |raw material |TAIWAN IMPORTER IN INDIA |cement chemicals |food & beverages chemicals |chloride |industrial resin |polyester resins |chemical raw materials |anti cancer drugs |iron chemicals |cp lr ar grade |POTASSIUM CHLORIDE |Ortho Phenyl Phenol |opp |antibacterial |2-Chloro 4,5-Dimethoxy 1,3,5-triazine |Triethyl Citrate |Ethyl chloro[(4-methoxyphenyl)hydrazono]acetate |Diethylene Glycol Liquid |deg-meg |Aluminium Ammonium Sulphate |alum |uv protection cosmetic |fatty alcohos |hydrogen gas |ANHYDROUS HYDROGEN CHLORIDE |organic synthesis |chemical solution |nickel solution |latexes |antiscalant chemical |xylidine chemicals |isomeric chemicals |adhesion |esters |melamine resin |moisture protection coatings |adsorbent |desiccant chemicals |coating chemicals |Polyhexanide |polyhexamethylene biguanide solution |PHMB |polyhexamethylene biguanide |antimicrobial |Inhibited Glycol Liquid |radiator coolant chemicals |Hydrogen Peroxide with Silver Nitrate |bio chemicals |4-Chlorosalicylic acid |chlorine derivatives |reagent chemicals |detecting chemicals |polycarbonates |Sorbitan Esters |monostearate |dispersing agents |Electroplating |aniline chemicals |plastic black masterbatch |carbon masterbatch |black masterbatch |medical grade |earth chemicals |dolomite |printing inks |quaternary phosphonium salts |stabilizer |toothpaste chemicals |gelling agent |thickener |chiral chemicals |isocyanates |diols chemicals |silicone process |titanate chemicals |imatinib raw materials |frp chemicals |frp chequered plates |frp products |frp gratings |Methyltrioctylammonium chloride |emulsion polymer |Polydiallyldimethylammonium chloride |diallyldimethylammonium chloride |PolyDADMAC |polyetheramines |Baxxodur |Benzyl tributyl ammonium chloride |pharmaceutical additives |saccharin |pharma probiotic chemicals |levulinate chemicals |bronopol |cooling water treatment |toys manufacturing chemicals |cept chemicals |flocculant |high pH chemicals |AA-AMPS chemicals |nanotechnology chemicals |nano powder chemicals |leather industry chemicals |sulfonated chemicals |epoxy |epoxy chemicals |epoxy floor coating |alcohol chemicals |Mecetronium ethylsulfate |hand sanitizers |Barium hydroxide octahydrate |Inositol (Myo-Inositol) |N-METHYL PYRROLIDONE |4-Morpholinopiperidine |surgical cleaning |COA & MSDS chemicals |pharmaceutical resins |glycinate chemicals |pharma distributor |tablet distributor |pcd pharma distributor |pyrophosphate chemicals |nitrification |pranlukast intermediates |balaji amines |binders |sealant |softeners |heptahydrate chemicals |oil chemicals |malaria oil |anti larva oil |moles |services |desalination plant chemicals |membrane chemicals |thiazides process chemicals |metal chemicals |ceramic chemicals |EDTA salts |Para Chloro Meta Cresol |pcmc |antiseptic |chemical |Foamaster |Propylene Glycol Liquid |Pioglitazone Hcl |absorbant |9-Anthracenemethanol |hydroxymethyl group |DIISOPROPYLAMINE |ro chemicals |reverse osmosis chemicals |zyme granules |Lanxess bayferrox |lanxess inorganic pigments |lanxess bayferrox oxides |ipa hand sanitizers |copolymers |homopolymers |basf polymers |nitric acid |hanwha corp |korea nitric acid |automobile chemicals |caprylate cosmetic chemicals |caprate group cosmetic chemicals |gnfc chemicals |ph control agent |antibiotic intermediates |petroleum pipeline chemicals |IP BP USP Grade Chemicals |#Poly-aluminium-chloride |GACL-PAC |Sodium Cyanate |POLYSORBATE 20 |Acetyl Tri(2-Ethylhexyl) Citrate |ATEHC |glycerine |Pine Oil |Phenyltrimethylammonium chloride |White Phenyl Concentrate |Concentrate |readymade phenyl |rwc booster |black phenyl |data of chemicals |barium chemicals |pest control agent |Glyoxal |Flavor and Fragrances |Liquid Diethyl Ethoxymethylene Malonate |bangalore |GFL CAUSTIC SODA |GUJARAT FLUOROCHEMICALS |lactate chemicals |chloride chemicals |orotate chemicals |removal chemicals |descaling agent |mundra port |nhava sheva port |silver testing chemicals |thiophene |cashew nuts |commodity |guar gum |licence |cast resin |boai nyk pharma pvp |PVA BASED FILM COATING |liquid chemicals |omeprazol drug intermediates |citral chemicals |amide chemicals |N-Propyl bromide |aerospace chemicals |aviation chemicals |adhesives |Dipropylene glycol |chelate |TETA |Benzisothiazolinone |Disodium Ethylenebis Dithiocarbamate |plastic chemicals |lactic acid |Veterinary API |gel based |ethanol based hand sanitizer |99% Polyethylene Glycol Liquid |Pharmaceutical Grade Menthol Crystal |anticorrosive agent chemicals |cleansing chemicals |ct scan chemicals |radio chemicals |pathology chemicals |x-ray chemicals |aspartate chemicals |oral pharmaceutical |textile paste |heat treatment salts |ready pellets |Ethylene glycol |Mono Ethylene Glycol Liquid |meg |monoethylene-glycol |PH EUR Grade pharma |biopolymers |hplc chemicals |locomotive steam chemicals |vaporization equipments |crude oil evaporation |OBPCP |Ortho Benzyl Para Chlorophenol |Monopropylene glycol USP |Triethylene glycol |Malathion Powder |Hydroxylammonium sulfate |cement |HPMC customizable film coating |Emulsion Stabiliser |glycine |stearate chemicals |ethyl chemicals |polymer for paper industry |thinner |toluic acid |Aliphatic Bromide |bromide chemicals |Docusate sodium |dioctyl sodium sulfosuccinate |doss |dss |Light Creosote Oil |Creosote oil |Cresylic Creosote |Tar oil |Furfuryl alcohol |Poly aluminium chloride liquid 9%, 14%, 17% |paracetamol powder |acetate chemicals |oleo chemicals |myristic acid |coatings |spandex fibers |coagulant chemicals |filler plastic |wetting agents |reducing agent chemicals |cooling tower chemicals |industrial water treatment |ketones chemicals |api powder |animal feed chemicals |epoxy resin |larvicide agro chemicals |drilling fluid chemicals |reducing agent |chemical manufacturer |chemical intermediates |anti caking agents |fire chemicals |solar cells chemicals |battery chemicals |ev chemicals |essential oils |chemical powder |Food Chemicals |Pharma Intermediate |paraffin oil |isomer chemicals |Ketoconazole IP BP USP |Ketoconazole IP BP USP powder |api manufacturer |EDTA Zinc |EDTA trisodium |EDTA tetrasodium salt |EDTA manganese |EDTA ferric |EDTA ferrous |EDTA iron |EDTA glycinate |EDTA disodium salt |EDTA copper |EDTA cobalt |EDTA Dipotassium |EDTA Copper chelate |EDTA chelated zinc |EDTA Calcium |edta salts manufacturer |edta chemicals |gujarat india edta salts |Boron Citrate Chelated |manufacturer in vadodara |Boron Citrate Chelated manufacturer |Ammonium Citrate Chelated |gujarat india Ammonium Citrate Chelated |LACTULOSE SOLUTION |Atorvastatin API |Lidocaine |manufacturer in india |calcium chemicals |peptide chemicals |laundry chemicals |hair formulation chemicals |pharma api |api intermediate

Manufacturer Categories

Have any question or need any business consultation?

Contact Us

Have any question or need any business consultation?

Contact Us
Chat with us  

Recently updated manufacturer

Opening Hours

    Subscribe Us

    Subscribe to our newsletter!
    PAT IMPEX INDIA

    Social share